DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf4 and traf5

DIOPT Version :9

Sequence 1:NP_477416.1 Gene:Traf4 / 33638 FlyBaseID:FBgn0026319 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_004914139.2 Gene:traf5 / 100491604 XenbaseID:XB-GENE-985638 Length:555 Species:Xenopus tropicalis


Alignment Length:508 Identity:114/508 - (22%)
Similarity:182/508 - (35%) Gaps:184/508 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 KHIMGSLVFCIHHKQGCKWSDELRKLKGHLNACKHDATQCPNK-CGAQIPRIMMTDHLQYTCTMR 160
            :.::..||:| .:...|.....|.:.:.||..|.::.|.|.|. |..|:.|..:..||:..|.:|
 Frog   100 REVLNLLVYC-KNSPACDVKVMLGRYQEHLGQCLYEMTLCSNDGCHDQMIRKELKGHLESECKLR 163

  Fly   161 RTRCEFCQSEFSGAGLEEHNGSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQREF 225
            :..|.:|:...:...|..|.|      :||:                                  
 Frog   164 QEACIYCKQTMASINLTIHVG------LYCQ---------------------------------- 188

  Fly   226 SADTLPLHAAQCPRAPLACPQRCDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLE 290
                  |:...||.   |||..|     ||.||:.|| .||....:.|:|...||.....|..::
 Frog   189 ------LYPVPCPN---ACPVTC-----PRAELDKHL-CECPEAELQCTFSNYGCNVMVKRSKVK 238

  Fly   291 AHLESNAAAHLSLMV-------------------------------------------------- 305
            .|.::....|:..::                                                  
 Frog   239 EHEDTFLRDHMLYVLNRNMKLEEQVLGLQQNLDLKEHQIQQLSDTVKWCEKECHQFGQFTGSNGN 303

  Fly   306 ALSSR-------------QGQQIQMLKSAVSKLSI------------------------------ 327
            :|||.             :.|.||::....|:|.:                              
 Frog   304 SLSSTKTLASYIDKSMWLEEQVIQLVSKEHSRLDLRPILDTLESTKQRLSTLEAYKDRIDNLDGQ 368

  Fly   328 ----------------------------NYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQ 364
                                        :|.|.|:|||||:..|..||.....:.:.|..||||.
 Frog   369 FKKHDVLLSNHKMQMTSNEERFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSW 433

  Fly   365 YGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESF 429
            .||:|.|..:|||:|.|:.:.:|:|..|:.||:|::|.|||...:|..|.:|..:...  :.:.|
 Frog   434 CGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNH--ITDVF 496

  Fly   430 VPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRP---FIKGDTVFLRVKVD 479
            ..||...:|:||.:|.: :..|.|||.||..|.:..   :||.||:|:::.||
 Frog   497 RADPNSSSFKRPDSEMN-IASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVD 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf4NP_477416.1 PLN03086 <109..206 CDD:178635 22/97 (23%)
zf-TRAF 233..292 CDD:424248 19/58 (33%)
MATH_TRAF4 331..479 CDD:239750 56/150 (37%)
traf5XP_004914139.2 mRING-HC-C3HC3D_TRAF5 42..84 CDD:319556
zf-TRAF 127..182 CDD:424248 16/54 (30%)
zf-TRAF 187..240 CDD:424248 21/101 (21%)
MATH 400..548 CDD:351761 56/150 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48494
OrthoDB 1 1.010 - - D391991at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.