DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and CB5LP

DIOPT Version :10

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_176265.1 Gene:CB5LP / 842360 AraportID:AT1G60660 Length:121 Species:Arabidopsis thaliana


Alignment Length:64 Identity:24/64 - (37%)
Similarity:35/64 - (54%) Gaps:9/64 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RPINKMRYYLKDEVVSHNKKDDCWVIIHRNIYDLTPMLKDRFDNWNRTLDYLVAHAGKDLTHFF 66
            ||    :.|.|.||..|||::|||:||...:||:|..:::....     |.::.|||.|.|..|
plant    45 RP----KSYSKSEVAVHNKRNDCWIIIKDKVYDITSYVEEHPGG-----DAILDHAGDDSTDGF 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 13..>63 CDD:459698 19/49 (39%)
CB5LPNP_176265.1 Cyt-b5 50..121 CDD:459698 21/55 (38%)

Return to query results.
Submit another query.