DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and CB5-C

DIOPT Version :10

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_182188.1 Gene:CB5-C / 819277 AraportID:AT2G46650 Length:132 Species:Arabidopsis thaliana


Alignment Length:56 Identity:18/56 - (32%)
Similarity:30/56 - (53%) Gaps:8/56 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EVVSHNKKDDCWVIIHRNIYDLTPMLKDR--FDNWNRTLDYLVAHAGKDLTHFFHE 68
            :|..|..|:|||::||..:||::..:.:.  .||      .|:|..|||.:..|.:
plant     9 DVAKHKCKNDCWILIHGKVYDISTFMDEHPGGDN------VLLAVTGKDASIDFED 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 13..>63 CDD:459698 17/49 (35%)
CB5-CNP_182188.1 Cyt-b5 6..78 CDD:459698 18/56 (32%)

Return to query results.
Submit another query.