DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and CB5-B

DIOPT Version :10

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_180831.1 Gene:CB5-B / 817832 AraportID:AT2G32720 Length:134 Species:Arabidopsis thaliana


Alignment Length:97 Identity:27/97 - (27%)
Similarity:46/97 - (47%) Gaps:19/97 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NKMRYYLKDEVVSHNKKDDCWVIIHRNIYDLTPMLKDR--FDNWNRTLDYLVAHAGKDLTHFFHE 68
            ::.:.:...||..||:..|||::|:..:|::|..|:|.  .|      |.|::..|||.|..|.:
plant     3 DEAKIFTLSEVSEHNQAHDCWIVINGKVYNVTKFLEDHPGGD------DVLLSSTGKDATDDFED 61

  Fly    69 NGEPRT-----------EISPSTGRPRVLFPP 89
            .|...:           ||.|:|...:|.:.|
plant    62 VGHSESAREMMEQYYVGEIDPTTIPKKVKYTP 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 13..>63 CDD:459698 18/51 (35%)
CB5-BNP_180831.1 Cyt-b5 9..81 CDD:459698 22/77 (29%)

Return to query results.
Submit another query.