DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and CYB5B

DIOPT Version :10

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_085056.2 Gene:CYB5B / 80777 HGNCID:24374 Length:150 Species:Homo sapiens


Alignment Length:112 Identity:26/112 - (23%)
Similarity:40/112 - (35%) Gaps:35/112 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YYLKDEVVSHNKKDDCWVIIHRNIYDLTPMLKDRFDNWNRTLDYLVAHAGKDLTHFFHENGEPRT 74
            ||..:||...|...:.|::||..:||:|..|.:....    .:.|:..||.|.:..|.:.|....
Human    26 YYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGG----EEVLLEQAGVDASESFEDVGHSSD 86

  Fly    75 -----------EISPSTGRPRVLFPPILEVAISEFCKTPGEMWSQDP 110
                       :|.||..:|                    |..|:||
Human    87 AREMLKQYYIGDIHPSDLKP--------------------ESGSKDP 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 13..>63 CDD:459698 14/49 (29%)
CYB5BNP_085056.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Cyt-b5 28..100 CDD:459698 16/75 (21%)
MIP <123..148 CDD:444743
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.