DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and cyb5d1

DIOPT Version :9

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001017684.1 Gene:cyb5d1 / 795592 ZFINID:ZDB-GENE-050417-173 Length:214 Species:Danio rerio


Alignment Length:228 Identity:75/228 - (32%)
Similarity:123/228 - (53%) Gaps:35/228 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 INKMRYYLKDEVVSHNKKDDCWVIIHRNIYDLTPMLKDRFDNWNRTLDYLVAHAGKDLTHFFHEN 69
            :.:.:|:..:||..||..:|.||.....:|||||:|:..  ..:..|..::..||||::|:|   
Zfish     1 MRRSKYFTPNEVSLHNTINDIWVSYLGKVYDLTPLLEAY--KGDVLLKPIIECAGKDISHWF--- 60

  Fly    70 GEPRTE-----ISPSTG-----RPRVLF----PPILEVAISEFCKTPGEMWSQDPFYHIGTVTKR 120
             :|:|:     :.|.||     .||..|    ||...   :::....|:.|.:|..|.:|.::.:
Zfish    61 -DPKTKDILTHVDPLTGCIKYYTPRGRFIHIPPPCPR---TDWANNFGKPWWKDNRYEVGLLSAK 121

  Fly   121 ARLIRIVNTLTAQTQYMTVCNEDSIYDIQQKYKQRYNHHAGSYEWRKFSNGGKSCSILNLNGTLD 185
            .|.|||:||||:|.|.:.||:|:|:.:|..:| ..||.||.||.|:      .|...|:::.||.
Zfish   122 TRWIRIINTLTSQEQKLEVCSEESLDEILHRY-LFYNSHAASYTWK------LSGINLDMSKTLS 179

  Fly   186 ENGLTDDED-----SNVELPPPSIWLYYTDDIT 213
            |||:.::::     .:..|..|||.||:.||:|
Zfish   180 ENGIPEEDEFYCGSPDCNLFSPSICLYFNDDLT 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 10..>70 CDD:278597 21/59 (36%)
cyb5d1NP_001017684.1 Cyt-b5 6..>60 CDD:278597 20/55 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578430
Domainoid 1 1.000 80 1.000 Domainoid score I8565
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H15945
Inparanoid 1 1.050 111 1.000 Inparanoid score I4859
OMA 1 1.010 - - QHG56329
OrthoDB 1 1.010 - - D1534331at2759
OrthoFinder 1 1.000 - - FOG0007293
OrthoInspector 1 1.000 - - oto41768
orthoMCL 1 0.900 - - OOG6_104997
Panther 1 1.100 - - LDO PTHR21281
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5596
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.