DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and Cyb5b

DIOPT Version :10

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_079834.2 Gene:Cyb5b / 66427 MGIID:1913677 Length:146 Species:Mus musculus


Alignment Length:86 Identity:22/86 - (25%)
Similarity:37/86 - (43%) Gaps:15/86 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YYLKDEVVSHNKKDDCWVIIHRNIYDLTPMLKDRFDNWNRTLDYLVAHAGKDLTHFFHENGEPRT 74
            ||..:||...|..::.|::||..:||:|..|.:....    .:.|:..||.|.|..|.:.|....
Mouse    22 YYRLEEVAKRNSAEETWMVIHGRVYDITRFLSEHPGG----EEVLLEQAGADATESFEDVGHSPD 82

  Fly    75 -----------EISPSTGRPR 84
                       ::.||..:|:
Mouse    83 AREMLKQYYIGDVHPSDLKPK 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 13..>63 CDD:459698 14/49 (29%)
Cyb5bNP_079834.2 Cyt-b5 24..96 CDD:459698 17/75 (23%)
MIP <119..139 CDD:444743
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.