Sequence 1: | NP_608823.2 | Gene: | CG15429 / 33637 | FlyBaseID: | FBgn0031596 | Length: | 215 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005173509.1 | Gene: | cyb5r4 / 553685 | ZFINID: | ZDB-GENE-050522-225 | Length: | 577 | Species: | Danio rerio |
Alignment Length: | 265 | Identity: | 54/265 - (20%) |
---|---|---|---|
Similarity: | 83/265 - (31%) | Gaps: | 90/265 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 KDEVVSHNKKDDCWVIIHRNIYDLTPML------------------KDRFDNWNRTLDY------ 53
Fly 54 -------------LVAHAGKDLTHFFHENGEPRTEISPSTGRPRVLFPPILEVAISEFCKTPGEM 105
Fly 106 WSQ-DPFYHIGTVTKRA-------------------------------RL-IRIVNTLTAQTQY- 136
Fly 137 ---MTVCNEDSIYDIQQKYKQRYNHHAGSYEWRKFSNGGKSCSILNLNGTLDENGLTDDEDSNVE 198
Fly 199 LPPPS 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15429 | NP_608823.2 | Cyt-b5 | 10..>70 | CDD:278597 | 22/93 (24%) |
cyb5r4 | XP_005173509.1 | Cyt-b5 | 108..180 | CDD:278597 | 16/68 (24%) |
p23_NCB5OR | 228..314 | CDD:107240 | 14/85 (16%) | ||
cyt_b5_reduct_like | 336..575 | CDD:99780 | 7/29 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5274 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |