DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and cyb5r4

DIOPT Version :9

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_005173509.1 Gene:cyb5r4 / 553685 ZFINID:ZDB-GENE-050522-225 Length:577 Species:Danio rerio


Alignment Length:265 Identity:54/265 - (20%)
Similarity:83/265 - (31%) Gaps:90/265 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KDEVVSHNKKDDCWVIIHRNIYDLTPML------------------KDRFDNWNRTLDY------ 53
            :||:..||.|.|||..|...:|:|:..:                  .|.||..:|.::|      
Zfish   111 EDELKKHNTKKDCWTCIRGMVYNLSAYMDFHPGGEEELMRAAGIDSTDLFDEVHRWVNYESMLKE 175

  Fly    54 -------------LVAHAGKDLTHFFHENGEPRTEISPSTGRPRVLFPPILEVAISEFCKTPGEM 105
                         |.||..|  |...|.||..    :|.:.||..|..|     :......|...
Zfish   176 CLVGRMAVKPSPALQAHTEK--TESTHLNGLS----APPSLRPEPLSAP-----LPAKDHRPRYD 229

  Fly   106 WSQ-DPFYHIGTVTKRA-------------------------------RL-IRIVNTLTAQTQY- 136
            |.| |...:|...|||.                               || .|:.:.:..||.: 
Zfish   230 WFQTDGTVNIVVYTKRKIPSAGCAVVDLQDDNLRVEMLLGRMSYLLYWRLSSRVQDHVDVQTAHS 294

  Fly   137 ---MTVCNEDSIYDIQQKYKQRYNHHAGSYEWRKFSNGGKSCSILNLNGTLDENGLTDDEDSNVE 198
               :.:|...|:.:...:..|...||....:.:......:.|.:|:.........|.     .::
Zfish   295 VGKVQLCLRKSVKEKWTQLGQSLEHHDTFIQCKDRGLFYRECVLLSKTDVTHNTQLL-----RLQ 354

  Fly   199 LPPPS 203
            |||.|
Zfish   355 LPPGS 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 10..>70 CDD:278597 22/93 (24%)
cyb5r4XP_005173509.1 Cyt-b5 108..180 CDD:278597 16/68 (24%)
p23_NCB5OR 228..314 CDD:107240 14/85 (16%)
cyt_b5_reduct_like 336..575 CDD:99780 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.