DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and CG11257

DIOPT Version :9

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_611419.1 Gene:CG11257 / 37227 FlyBaseID:FBgn0034442 Length:535 Species:Drosophila melanogaster


Alignment Length:209 Identity:42/209 - (20%)
Similarity:72/209 - (34%) Gaps:72/209 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KDEVVSHNKKDDCWVIIHRNIYDLTPMLKDRFDNWNRTLDYLVAHAGKDLTHFFHE----NGEPR 73
            :.|:..|||.||.|:.|...::::|..:    |.....:|.|:...|:|.|..|.|    ...|:
  Fly    92 RTELARHNKIDDAWMAIRGRVFNVTRYM----DFHPGGVDELMRGVGRDATKLFDEVHAWVNYPQ 152

  Fly    74 ------------TEISPSTGRPR----VLFPPILEVAISEFCKTPGEMWSQDPFYHIGTVTKRAR 122
                        .|..|:...|:    :|.||.:         .|...|.|          :|:.
  Fly   153 LLGKCYVGPLKDNETKPAKESPQITNVILQPPEI---------VPRFDWIQ----------QRSE 198

  Fly   123 LIRIVNTLTAQTQYMTVCNEDSIYDIQQKYKQRYNHHAGSYEWRKFSNGGKSCSILNLNGTLDEN 187
            |..|..|.:.....:.|..:| :..:..:...::|.|:..::                       
  Fly   199 LTLIFYTRSLANPGLVVRRKD-LQQLSVRVLVQHNWHSFDFQ----------------------- 239

  Fly   188 GLTDDEDSNVELPP 201
             ||    :|||.||
  Fly   240 -LT----NNVEWPP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 10..>70 CDD:278597 17/60 (28%)
CG11257NP_611419.1 Cyt-b5 90..162 CDD:278597 18/73 (25%)
p23_NCB5OR 190..276 CDD:107240 17/98 (17%)
cyt_b5_reduct_like 295..533 CDD:99780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.