DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and Cyb5d1

DIOPT Version :9

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001178819.1 Gene:Cyb5d1 / 363629 RGDID:1559567 Length:228 Species:Rattus norvegicus


Alignment Length:227 Identity:78/227 - (34%)
Similarity:125/227 - (55%) Gaps:36/227 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KMRYYLKDEVVSHNKKDDCWVIIHRNIYDLTPMLKDRFDNWNRTLDYLVAHAGKDLTHFFHENGE 71
            |.||:...||..||:.:|.||.....:|:|||:::: |.. :..|..::..||:|::|:|    :
  Rat    16 KRRYFTPSEVAEHNQPEDLWVSYLGFVYNLTPLVQE-FKG-DLLLKPILEVAGQDISHWF----D 74

  Fly    72 PRTE-----ISPSTG-----RPRVLF----PPILEVAISEFCKTPGEMWSQDPFYHIGTVTKRAR 122
            |:|:     |.|.||     .||..|    ||:..   |::....|..|.:...|.:|.::.:.|
  Rat    75 PKTKDIRKHIDPLTGCVRYRTPRGRFVHIPPPLPR---SDWANDFGIPWWKGLNYQVGRLSAQTR 136

  Fly   123 LIRIVNTLTAQTQYMTVCNEDSIYDIQQKYKQRYNHHAGSYEWRKFSNGGKSCSILNLNGTLDEN 187
            .|||:||||:|...:.|...||:::|..:|.. ||.||.||.|:   ..||:   ||::.||:||
  Rat   137 NIRIINTLTSQEHTLEVGALDSMWEILHRYLP-YNAHAASYTWK---YDGKN---LNMDQTLEEN 194

  Fly   188 GLTDDEDS----NVE--LPPPSIWLYYTDDIT 213
            |:.|:|:.    |::  |..|:|.||:.||:|
  Rat   195 GIRDEEEEFDFLNMDGTLHTPAILLYFNDDLT 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 10..>70 CDD:278597 19/59 (32%)
Cyb5d1NP_001178819.1 Cyt-b5 19..>73 CDD:278597 18/55 (33%)
UBQ 143..199 CDD:214563 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338820
Domainoid 1 1.000 75 1.000 Domainoid score I8883
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H15945
Inparanoid 1 1.050 106 1.000 Inparanoid score I4834
OMA 1 1.010 - - QHG56329
OrthoDB 1 1.010 - - D1534331at2759
OrthoFinder 1 1.000 - - FOG0007293
OrthoInspector 1 1.000 - - oto95447
orthoMCL 1 0.900 - - OOG6_104997
Panther 1 1.100 - - LDO PTHR21281
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.