powered by:
Protein Alignment CG15429 and CG3566
DIOPT Version :9
Sequence 1: | NP_608823.2 |
Gene: | CG15429 / 33637 |
FlyBaseID: | FBgn0031596 |
Length: | 215 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_572304.5 |
Gene: | CG3566 / 31562 |
FlyBaseID: | FBgn0029854 |
Length: | 117 |
Species: | Drosophila melanogaster |
Alignment Length: | 55 |
Identity: | 21/55 - (38%) |
Similarity: | 30/55 - (54%) |
Gaps: | 4/55 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 VVSHNKKDDCWVIIHRNIYDLTPMLKDRFDNWNRTLDYLVAHAGKDLTHFFHENG 70
|..|||..|.||:|...:||:| |.|.::.... :.||..||:|.|..|::.|
Fly 10 VNEHNKATDLWVVIDNKVYDVT---KFRLEHPGGE-ESLVDEAGRDATKAFNDVG 60
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5274 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.