DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and CG3566

DIOPT Version :10

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster


Alignment Length:55 Identity:21/55 - (38%)
Similarity:30/55 - (54%) Gaps:4/55 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VVSHNKKDDCWVIIHRNIYDLTPMLKDRFDNWNRTLDYLVAHAGKDLTHFFHENG 70
            |..|||..|.||:|...:||:|   |.|.::.... :.||..||:|.|..|::.|
  Fly    10 VNEHNKATDLWVVIDNKVYDVT---KFRLEHPGGE-ESLVDEAGRDATKAFNDVG 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 13..>63 CDD:459698 18/46 (39%)
CG3566NP_572304.5 Cyt-b5 6..78 CDD:459698 21/55 (38%)

Return to query results.
Submit another query.