DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and Fa2h

DIOPT Version :9

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001129055.1 Gene:Fa2h / 307855 RGDID:1310347 Length:372 Species:Rattus norvegicus


Alignment Length:105 Identity:25/105 - (23%)
Similarity:35/105 - (33%) Gaps:29/105 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KDRFDNWNRTLDYLVAHAGKDLTHFFHENGEPRTEISPSTGRPRVLFPPILEVAISEFCKTPGEM 105
            ||..| |.:.|.:.|.|.|:....:.|:          ...||..||...|   |..|.||   :
  Rat   121 KDLVD-WQKPLLWQVGHLGEKYDEWVHQ----------PVARPIRLFHSDL---IEAFSKT---V 168

  Fly   106 WSQDPFYHIGTVTKRARLIRIVNTLTAQTQYMTVCNEDSI 145
            |...|            :|.:...|.....|.....:|:|
  Rat   169 WYSVP------------IIWVPLVLYLSWSYYRTLTQDNI 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 10..>70 CDD:278597 9/28 (32%)
Fa2hNP_001129055.1 Cyt-b5 12..86 CDD:395121
FA_hydroxylase 124..372 CDD:412761 23/102 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.