DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and Cyb5r4

DIOPT Version :9

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_077157.2 Gene:Cyb5r4 / 266690 MGIID:2386848 Length:528 Species:Mus musculus


Alignment Length:262 Identity:52/262 - (19%)
Similarity:92/262 - (35%) Gaps:87/262 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KDEVVSHNKKDDCWVIIHRNIYDLTPMLK------------------DRFDNWNRTLDY------ 53
            ::|:..||||:|||:.|...:|:::|.::                  |.|:..:|.::|      
Mouse    59 EEELKKHNKKEDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGADGTDLFNEVHRWVNYESMLKE 123

  Fly    54 -LV------------AHAGKDLTHFFHENGE-PRTEISPSTGRPRVLFPPILEVAISEFCKTPGE 104
             ||            .|.||.:.     ||. |::::|.:..|      .:.:....|...:|..
Mouse   124 CLVGRMAVKPAVPKDCHEGKRVL-----NGMLPKSQMSDTLPR------DVTDTLPREDLSSPSY 177

  Fly   105 MWSQDPFYHIGTVTKRARLIRIVNTLTAQTQYMTVCNEDSIYDIQQK--------YKQRYNHHAG 161
            .|.|         |:.:      .|:...|:...:..:..|.|:|..        ....|..|.|
Mouse   178 DWFQ---------TESS------VTIVVYTKQKNISLDSVIVDLQDDSLRAEAVIKDHSYLVHVG 227

  Fly   162 -------SYEWRKFSNGGKSCSILNLNGTLDENGLTDD-EDSNVELPPPSIWLYY-------TDD 211
                   ::..|...|.||...:|....::....|.|. |..:..:|.....|||       .:|
Mouse   228 LSHEVQENFSVRVIENVGKIEIVLQKKESVSWQCLGDHLEKHDSFIPKKDTGLYYRRCQLISKED 292

  Fly   212 IT 213
            :|
Mouse   293 VT 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 10..>70 CDD:278597 20/93 (22%)
Cyb5r4NP_077157.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Cyt-b5 56..128 CDD:278597 17/68 (25%)
p23_NCB5OR 177..263 CDD:107240 16/100 (16%)
cyt_b5_reduct_like 285..526 CDD:99780 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.