DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and F58B4.2

DIOPT Version :10

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001379137.1 Gene:F58B4.2 / 186494 WormBaseID:WBGene00010235 Length:89 Species:Caenorhabditis elegans


Alignment Length:58 Identity:15/58 - (25%)
Similarity:31/58 - (53%) Gaps:5/58 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NKMRYYLKDEVVSHNKKDDCWVIIHRNIYDLTPMLKDRFDNWNRTLDYLVAHAGKDLT 63
            :.::.|.:.:|..|...||.|::....:|::||     :.|.:.....::.:||||:|
 Worm     7 DNLKEYTRSQVEQHCTHDDLWLLFRDKVYNMTP-----YFNQHPGGLAILRYAGKDVT 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 13..>63 CDD:459698 13/49 (27%)
F58B4.2NP_001379137.1 Cyt-b5 13..88 CDD:459698 14/52 (27%)

Return to query results.
Submit another query.