DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and cytb-5.1

DIOPT Version :10

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_510335.2 Gene:cytb-5.1 / 181510 WormBaseID:WBGene00007848 Length:134 Species:Caenorhabditis elegans


Alignment Length:56 Identity:16/56 - (28%)
Similarity:25/56 - (44%) Gaps:4/56 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EVVSHNKKDDCWVIIHRNIYDLTPMLKDRFDNWNRTLDYLVAHAGKDLTHFFHENG 70
            |:..||.....|::|...::|:|..|    |......:.|:..||.|.|..|.:.|
 Worm    11 EIAEHNTNKSAWLVIGNKVFDVTKFL----DEHPGGCEVLLEQAGSDGTEAFEDVG 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 13..>63 CDD:459698 13/47 (28%)
cytb-5.1NP_510335.2 Cyt-b5 8..80 CDD:459698 16/56 (29%)

Return to query results.
Submit another query.