DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and fath-1

DIOPT Version :9

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_492678.1 Gene:fath-1 / 172882 WormBaseID:WBGene00007707 Length:316 Species:Caenorhabditis elegans


Alignment Length:100 Identity:19/100 - (19%)
Similarity:37/100 - (37%) Gaps:33/100 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERPINKMRYYLKDEVVSHNKKDDCWVIIH---RNIYDLTPMLKDR------------------FD 45
            |..:::..::.|....|.|:     :::|   ..::..|||..||                  :.
 Worm   179 EYSLHRWVFHWKPSPDSPNQ-----ILLHFLAHGLHHKTPMDGDRLVFPPVPATLIVGIFYLIYS 238

  Fly    46 NWNRTLDYLVAHAGK-------DLTHFFHENGEPR 73
            |..:...:....|||       |:.|::..:|.||
 Worm   239 NTFQWPVFCAFGAGKLFGYVTYDMVHYYLHHGSPR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 10..>70 CDD:278597 15/87 (17%)
fath-1NP_492678.1 Cyt-b5 6..72 CDD:278597
FA_hydroxylase 90..311 CDD:294712 18/99 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.