DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and Cyb5r4

DIOPT Version :9

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_596918.3 Gene:Cyb5r4 / 171015 RGDID:621834 Length:520 Species:Rattus norvegicus


Alignment Length:247 Identity:56/247 - (22%)
Similarity:89/247 - (36%) Gaps:65/247 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KDEVVSHNKKDDCWVIIHRNIYDLTPMLKDRFDNWNRTLDYLVAHAGKDLTHFFHE-----NGEP 72
            ::|:..||||||||:.|...:|:::|.::.....    .|.|:..||.|.|..|:|     |.|.
  Rat    59 EEELKKHNKKDDCWICIRGFVYNVSPYMEYHPGG----EDELMRAAGADGTDLFNEVHRWVNYES 119

  Fly    73 --------RTEISPSTGR-----PRVL---FP--PILEVAISEFCKTPGEMWSQDPFYHIGTVTK 119
                    |..:.|:..:     .|||   .|  .:.:....|...:|...|.|         |:
  Rat   120 MLKECLVGRMAVKPAVPKDCHEGKRVLNGMLPKSQVTDTLPREGPSSPSYDWFQ---------TE 175

  Fly   120 RARLIRIVNTLTAQTQYMTVCNEDSIYDIQQK--------YKQRYNHHAG-------SYEWRKFS 169
            .:      .|:...|:...:..:..|.|:|..        ....|..|.|       ::..|...
  Rat   176 SS------VTIVIYTKQKNINLDSVIVDLQDDSLRAEAVIKDHSYLIHIGLSHEVQENFSVRVIE 234

  Fly   170 NGGKSCSILNLNGTLDENGLTDD-EDSNVELPPPSIWLYY-------TDDIT 213
            |.||...:|....|:....|.|. |..:..:|.....|||       .:|:|
  Rat   235 NVGKIEIVLQKKETVSWKCLGDPLEKHDSFIPKKDTGLYYRQCQLISKEDVT 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 10..>70 CDD:278597 20/61 (33%)
Cyb5r4NP_596918.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Cyt-b5 56..128 CDD:278597 22/72 (31%)
p23_NCB5OR 169..255 CDD:107240 17/100 (17%)
cyt_b5_reduct_like 277..518 CDD:99780 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.