DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15429 and Cyb5a

DIOPT Version :10

Sequence 1:NP_608823.2 Gene:CG15429 / 33637 FlyBaseID:FBgn0031596 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_080073.1 Gene:Cyb5a / 109672 MGIID:1926952 Length:134 Species:Mus musculus


Alignment Length:63 Identity:20/63 - (31%)
Similarity:30/63 - (47%) Gaps:4/63 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MRYYLKDEVVSHNKKDDCWVIIHRNIYDLTPMLKDRFDNWNRTLDYLVAHAGKDLTHFFHENG 70
            ::||..:|:..|......|||:|..:||||..|::....    .:.|...||.|.|..|.:.|
Mouse     9 VKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGG----EEVLREQAGGDATENFEDVG 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15429NP_608823.2 Cyt-b5 13..>63 CDD:459698 15/49 (31%)
Cyb5aNP_080073.1 Cyt-b5 13..85 CDD:459698 18/59 (31%)

Return to query results.
Submit another query.