DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atet and Abca4

DIOPT Version :9

Sequence 1:NP_001097079.1 Gene:Atet / 33636 FlyBaseID:FBgn0020762 Length:832 Species:Drosophila melanogaster
Sequence 2:NP_001101191.1 Gene:Abca4 / 310836 RGDID:1309445 Length:2290 Species:Rattus norvegicus


Alignment Length:198 Identity:70/198 - (35%)
Similarity:107/198 - (54%) Gaps:12/198 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 FRNGEITAIMGPSGAGKSTLMNILAGYKTAQLSGSVLINSK--ERNLRRFRKLSCYIMQDDVLIA 235
            |...:|||.:|.:||||:|.::||.|. ....||:|||..|  |.:|...|:......|.::|..
  Rat   931 FYENQITAFLGHNGAGKTTTLSILTGL-LPPTSGTVLIGGKDIEISLDAVRQSLGMCPQHNILFH 994

  Fly   236 NLTVREAMMVAANLKLGKNMISYAKV-VVVEEILETIGLKESVNTLTCNLSGGQRKRLSIALELV 299
            :|||.|.::..|.|| |:   |:.:. :.:|.:||..||....|....:||||.:::||:|:..|
  Rat   995 HLTVAEHILFYAQLK-GR---SWEEARLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFV 1055

  Fly   300 NNPPVMFFDEPTSGLDSSTCFQLISLLRSLARGGRTIV-CTIHQPSARLFEKFDHLYLLAQGQCV 363
            .:..|:..||||||:|..:...:..||... |.||||: .|.|...|.|..  |.:.:::||:..
  Rat  1056 GDSKVVVLDEPTSGVDPYSRRSIWDLLLKY-RSGRTIIMSTHHMDEADLLG--DRIAIISQGRLY 1117

  Fly   364 YEG 366
            ..|
  Rat  1118 CSG 1120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AtetNP_001097079.1 3a01204 137..825 CDD:273361 70/198 (35%)
ABCG_EPDR 142..366 CDD:213180 69/196 (35%)
ABC2_membrane 564..767 CDD:279410
Abca4NP_001101191.1 rim_protein 1..2249 CDD:130324 70/198 (35%)
ABC_subfamily_A 907..1126 CDD:213230 70/198 (35%)
ABC_subfamily_A 1915..2135 CDD:213230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.