Sequence 1: | NP_001097079.1 | Gene: | Atet / 33636 | FlyBaseID: | FBgn0020762 | Length: | 832 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001101191.1 | Gene: | Abca4 / 310836 | RGDID: | 1309445 | Length: | 2290 | Species: | Rattus norvegicus |
Alignment Length: | 198 | Identity: | 70/198 - (35%) |
---|---|---|---|
Similarity: | 107/198 - (54%) | Gaps: | 12/198 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 173 FRNGEITAIMGPSGAGKSTLMNILAGYKTAQLSGSVLINSK--ERNLRRFRKLSCYIMQDDVLIA 235
Fly 236 NLTVREAMMVAANLKLGKNMISYAKV-VVVEEILETIGLKESVNTLTCNLSGGQRKRLSIALELV 299
Fly 300 NNPPVMFFDEPTSGLDSSTCFQLISLLRSLARGGRTIV-CTIHQPSARLFEKFDHLYLLAQGQCV 363
Fly 364 YEG 366 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Atet | NP_001097079.1 | 3a01204 | 137..825 | CDD:273361 | 70/198 (35%) |
ABCG_EPDR | 142..366 | CDD:213180 | 69/196 (35%) | ||
ABC2_membrane | 564..767 | CDD:279410 | |||
Abca4 | NP_001101191.1 | rim_protein | 1..2249 | CDD:130324 | 70/198 (35%) |
ABC_subfamily_A | 907..1126 | CDD:213230 | 70/198 (35%) | ||
ABC_subfamily_A | 1915..2135 | CDD:213230 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |