DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atet and Abca6

DIOPT Version :9

Sequence 1:NP_001097079.1 Gene:Atet / 33636 FlyBaseID:FBgn0020762 Length:832 Species:Drosophila melanogaster
Sequence 2:XP_006247716.1 Gene:Abca6 / 303639 RGDID:1308998 Length:1630 Species:Rattus norvegicus


Alignment Length:414 Identity:107/414 - (25%)
Similarity:178/414 - (42%) Gaps:78/414 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 PQRP------PVDIEFCDISYSVTDSHR-RGFKTILKSVSGKFR----------NGEITAIMGPS 185
            |:.|      |||.|     |...::.| |..:...|..|||..          ..:|||::|..
  Rat   461 PELPSDEYFEPVDPE-----YQGKEAIRIRNIRKEYKGKSGKVEALKGLFFDVYESQITAVLGHG 520

  Fly   186 GAGKSTLMNILAGYKTAQLSGSVLINSKE----RNLRRFRKLSCYIMQDDVLIANLTVREAMMVA 246
            |||||:|:|||.|. :...||...:.:|.    ::|:..||:.....|.:|....|||:|.:.:.
  Rat   521 GAGKSSLLNILNGL-SVPTSGLATVYNKNLSEMQDLKEIRKMIGVCPQHNVQFDALTVKENLTLF 584

  Fly   247 ANLKLGKNMISYAKVVVVEEILETIGLKESVNTLTCNLSGGQRKRLSIALELVNNPPVMFFDEPT 311
            ||:   |.::..:....|::||..:.::...:.|..:||.||:::|:..:.::.:|.::..||||
  Rat   585 ANI---KGIVPQSVAQEVQQILSELDMQTIQDELAEHLSEGQKRKLTFGVAILGDPRILLLDEPT 646

  Fly   312 SGLDSSTCFQLISLLRSLARGGRTIVCTIHQPSARLFEKFDHLYLLAQGQCVY-EGRVK--GLVP 373
            :|||..:..::...|:. .|..|.|:.     |.:..::.|   :||..:.:. .|.:|  |...
  Rat   647 AGLDPFSRQRVWGFLKE-RRADRVILF-----STQFTDEAD---ILADRKVILSNGALKCTGSSV 702

  Fly   374 YLS---SLGYECPSYHNPADYVLEVASGEYGDAVPKLVDAVKSGACKKYAHKD---YVLTLAQKG 432
            :|.   .|||....:.|      |....|   .:...::....||..|...|:   |.|.|.:..
  Rat   703 FLKRKWGLGYHLSLFMN------ETCDSE---QLTSFINHHIPGAKLKAKTKEKLVYTLPLEKTS 758

  Fly   433 ----CNNDIIKGSGSGAEN-AMAILTLEDEKPPLEDRQLEPSIPVD-------------DPAELK 479
                ..:|:.|.||.|..| .:::.||.:....||.   |||...|             :..|:.
  Rat   759 KFPEFFSDLDKYSGQGLMNYEVSMSTLNEVFMNLEG---EPSTTQDFEKGETLTDSDSLNEMEVA 820

  Fly   480 PPKLETQQSQNSDCSVVNMPTNAV 503
            ||.|...|...|..|:..|...|:
  Rat   821 PPSLSKAQKTMSAMSLWRMQVCAI 844

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AtetNP_001097079.1 3a01204 137..825 CDD:273361 107/414 (26%)
ABCG_EPDR 142..366 CDD:213180 65/239 (27%)
ABC2_membrane 564..767 CDD:279410
Abca6XP_006247716.1 ABC2_membrane_3 35..420 CDD:289468
ABC2_membrane_4 220..409 CDD:289500
CcmA 480..795 CDD:224054 87/339 (26%)
ABC_subfamily_A 482..705 CDD:213230 63/235 (27%)
ABC2_membrane_3 859..1171 CDD:289468
ABC2_membrane_4 1007..1178 CDD:289500
CcmA 1279..1605 CDD:224054
ABC_subfamily_A 1300..1514 CDD:213230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.