DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and CD86

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_787058.5 Gene:CD86 / 942 HGNCID:1705 Length:329 Species:Homo sapiens


Alignment Length:216 Identity:49/216 - (22%)
Similarity:85/216 - (39%) Gaps:42/216 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 WYEQETST-SELFNGRLHLVENHPEF-GRAS-------VNLTAIRESDQGWYHCQVSFPNRSPSV 136
            |.:||... :|::.|:......|.:: ||.|       :.|..::..|:|.|.|.:.....:..:
Human    57 WQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMI 121

  Fly   137 RNNGTAYHLAVQGG-SLIRIPPVNQTIREGQTAFFHCVMKH--PE-----------NSQASWYKD 187
            |.:.....|:|... |...|.|:: .|.|.......|...|  ||           ||...:  |
Human   122 RIHQMNSELSVLANFSQPEIVPIS-NITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEY--D 183

  Fly   188 GVLLQEVQDLVRRFYMGPDGSLSID---PTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVI 249
            || :|:.||.|...|   |.|:|:.   |.:.|::..: |.:......|.::...:.::..    
Human   184 GV-MQKSQDNVTELY---DVSISLSVSFPDVTSNMTIF-CILETDKTRLLSSPFSIELEDP---- 239

  Fly   250 YAPPEVFLPY---GQPAVLDC 267
             .||...:|:   ..|.|:.|
Human   240 -QPPPDHIPWITAVLPTVIIC 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 14/55 (25%)
Ig 43..131 CDD:299845 14/58 (24%)
I-set 153..242 CDD:254352 25/104 (24%)
Ig 157..242 CDD:299845 24/100 (24%)
Ig_2 252..337 CDD:290606 6/19 (32%)
IG_like 260..327 CDD:214653 3/8 (38%)
I-set 341..428 CDD:254352
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
CD86NP_787058.5 IgV_CD86 28..133 CDD:319336 16/75 (21%)
Ig 136..221 CDD:325142 25/92 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.