DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and PAPLN

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001352835.1 Gene:PAPLN / 89932 HGNCID:19262 Length:1278 Species:Homo sapiens


Alignment Length:368 Identity:89/368 - (24%)
Similarity:131/368 - (35%) Gaps:101/368 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 SPSVRNNGTAYHLAVQG----------GSLIRIPPVNQTIREGQTAFFHCVMKHPENSQASWYKD 187
            ||:...:.::|.:::.|          |.|:|:...:.|..|               |||:|.||
Human   897 SPAPPFHSSSYRISLAGVEPSLVQAALGQLVRLSCSDDTAPE---------------SQAAWQKD 946

  Fly   188 GVLLQEVQDLVRRFYMGPDGSLSIDPTMMSDLGEYEC----------KVR----------NSDGE 232
            |   |.:.....|...  ||||.|.|....|.|.|.|          |::          .|:.|
Human   947 G---QPISSDRHRLQF--DGSLIIHPLQAEDAGTYSCGSTRPGRDSQKIQLRIIGGDMAVLSEAE 1006

  Fly   233 L------------------------------QTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDC 267
            |                              |.|......|.:.:|:.|.|      ||...:.|
Human  1007 LSRFPQPRDPAQDFGQAGAAGPLGAIPSSHPQPANRLRLDQNQPRVVDASP------GQRIRMTC 1065

  Fly   268 HFRANPPLKNLRWEKDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPV 332
            .....|| ..:.|::||....|   |....:.:|||..::|.....|.|||..:|  |.|.....
Human  1066 RAEGFPP-PAIEWQRDGQPVSS---PRHQLQPDGSLVISRVAVEDGGFYTCVAFN--GQDRDQRW 1124

  Fly   333 ISVIVLRPPIFSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQPLPADRFSL---S 394
            :.:.||.....|..|..:.:.: |:.|.|.|.......|.|    |.| :|.|:.||...:   .
Human  1125 VQLRVLGELTISGLPPTVTVPE-GDTARLLCVVAGESVNIR----WSR-NGLPVQADGHRVHQSP 1183

  Fly   395 GGNLTITGLVEGDRGIYECSATNEAATITAEAELMIENIAPRA 437
            .|.|.|..|...|.|.|.|||...:..::...|:.:.:.||.|
Human  1184 DGTLLIYNLRARDEGSYTCSAYQGSQAVSRSTEVKVVSPAPTA 1226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 28/138 (20%)
Ig 157..242 CDD:299845 27/134 (20%)
Ig_2 252..337 CDD:290606 22/84 (26%)
IG_like 260..327 CDD:214653 20/66 (30%)
I-set 341..428 CDD:254352 24/89 (27%)
IGc2 356..419 CDD:197706 22/65 (34%)
FN3 435..524 CDD:238020 2/3 (67%)
FN3 554..636 CDD:238020
PAPLNNP_001352835.1 TSP1 29..80 CDD:214559
ADAM_spacer1 183..298 CDD:310520
TSP1 308..361 CDD:214559
TSP1 369..424 CDD:214559
TSP1 424..481 CDD:214559
TSP1 488..539 CDD:214559
Kunitz_BPTI 753..805 CDD:278443
Papilin_u7 814..905 CDD:318767 2/7 (29%)
Ig 914..>978 CDD:325142 23/83 (28%)
I-set 1049..1119 CDD:254352 23/81 (28%)
IG 1139..1219 CDD:214652 24/85 (28%)
PLAC 1235..1267 CDD:312271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.