DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and Robo2

DIOPT Version :10

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_038944599.1 Gene:Robo2 / 84409 RGDID:620167 Length:1625 Species:Rattus norvegicus


Alignment Length:764 Identity:175/764 - (22%)
Similarity:268/764 - (35%) Gaps:209/764 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GSHVVFNCYIDFPFDAPIPYLVHWTKDNKKIFTWYEQETSTSELFNGRLHLVENHPEF-----GR 107
            |.....||..:   ..|.| .:.|.||.:::      ||...:..:.|:.|......|     ||
  Rat    68 GEPTTLNCKAE---GRPTP-TIEWYKDGERV------ETDKDDPRSHRMLLPSGSLFFLRIVHGR 122

  Fly   108 ASVNLTAIRESDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGGSLIRIPPVNQTIREGQTAFFHC 172
            .|       :.|:|.|.| |:......:|..|.:.....::..  .|..|.:..:..|:.|...|
  Rat   123 RS-------KPDEGTYVC-VARNYLGEAVSRNASLEVA
LLRDD--FRQNPTDVVVAAGEPAILEC 177

  Fly   173 --VMKHPENSQASWYKDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMSDLGEYECKVRNSDGELQT 235
              ...|||.: ..|.||.|.:.|.::  |....|  |.|.|..|..||.|.|.|...|..||..:
  Rat   178 QPPRGHPEPT-IYWKKDKVRIDEKEE--RISIRG--GKLMISNTRKSDAGMYTCVGTNMVGERDS 237

  Fly   236 AKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPLKNLRWEKD--GLLFDSYNVPGVFYK 298
            ..|.|.:..:...:..|....:...:||...|..:.:|. ..:||:||  .|....|::     |
  Rat   238 DPAELTV
FERPTFLRRPINQVVLEDEPAEFRCQVQGDPQ-PTVRWKKDDADLPRGRYDI-----K 296

  Fly   299 MNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIV--LRPPIFSVTPKAIYIQKLGEAAEL 361
            .:.:|...|......|:|.|...|.:|....|..::|.|  :.||.|.|.|:...:.: |.....
  Rat   297 DDYTLRIKKAISADEGTYVCIAENRVGKVEASATLTV
RVRPVAPPQFVVRPRDQIVAQ-GRTVTF 360

  Fly   362 PCEAIDRDGNNRPSIIWGRKDGQPL--------PADRFSLS-GGNLTITGLVEGDRGIYECSATN 417
            |||.   .||.:|::.|.::..|.|        |..|.|:| .|:||||.:...|.|.|.|.|..
  Rat   361 PCET---KGNPQPAVFWQKEGSQNLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALT 422

  Fly   418 EAATITAEAELMIENIA------------------------------------------------ 434
            .|.:|.|:|:|.:.::.                                                
  Rat   423 VAGSILAKAQLEVTDVLTDRPPPIILQGPINQTLAVDGTALLKCKATGEPLPVISWLKEGFTFLG 487

  Fly   435 --PRA-------------------PYNLTANS--------------------------------- 445
              |||                   .|...|.|                                 
  Rat   488 RDPRATIQDQGTLQIKNLRISDTGTYTCVATSSSGETSWSAVLDVTESGATISKNYDTNDLPGPP 552

  Fly   446 --------TETCITIRWQPGY--LRPNLEYTVWYRLMEA------PEWRTLRVLDKKVMEATVQH 494
                    |:..:|:.||||.  :.|...|     ::||      ..|:|:....|..: .||:.
  Rat   553 SKPQVTDVTKNSVTLSWQPGTPGVLPASAY-----IIEAFSQSVSNSWQTVANHVKTTL-YTVRG 611

  Fly   495 LQPGKEYEFMVLSQDKYG---DGMFSKQFRFQTLPSPIRADDFDAQQLQHDLGQVTAPAGGLGAP 556
            |:|...|.|||.:.:..|   ....|...|.|.:..|  |...|.:|:|.:||.||.   .|..|
  Rat   612 LRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQDISPP--AQGVDHRQVQKELGDVTV---RLHNP 671

  Fly   557 WNLTAISNQQGWLLHWEHPVQGLEGLR--------LYAVRWWKEPEHFLIGHAETFDNYYQLRHL 613
            ..||..:.|..|.:  :...|.::|.|        |.|...|:.    |.....| :....|.:|
  Rat   672 VVLTPTTVQVTWTV--DRQPQFIQGYRVMYRQTSGLQASTVWQN----LDAKVPT-ERSAVLVNL 729

  Fly   614 KEDTLFKVQVLAVGTETQ------QSVPSHELLIDVPSQRKVRALIIGS 656
            |:...::::|.....|.|      :::.:.|.....|.| .|..|.:||
  Rat   730 KKGVTYEIKVRPYFNEFQGMDSESKTIRTTEEAPSAPPQ-SVTVLTVGS 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 20/84 (24%)
Ig strand C 69..72 CDD:409512 0/2 (0%)
Ig strand E 108..112 CDD:409512 1/3 (33%)
Ig strand F 122..127 CDD:409512 2/4 (50%)
Ig 153..242 CDD:472250 29/90 (32%)
Ig strand B 168..172 CDD:409544 1/3 (33%)
Ig strand C 181..185 CDD:409544 0/3 (0%)
Ig strand E 207..211 CDD:409544 2/3 (67%)
Ig strand F 221..226 CDD:409544 2/4 (50%)
Ig strand G 235..238 CDD:409544 0/2 (0%)
Ig_3 247..322 CDD:464046 17/76 (22%)
Ig 341..428 CDD:472250 32/95 (34%)
Ig strand B 359..363 CDD:409353 0/3 (0%)
Ig strand C 375..380 CDD:409353 1/4 (25%)
Ig strand E 396..400 CDD:409353 2/3 (67%)
Ig strand F 410..415 CDD:409353 2/4 (50%)
Ig strand G 423..426 CDD:409353 1/2 (50%)
FN3 435..524 CDD:238020 30/159 (19%)
FN3 554..636 CDD:238020 19/95 (20%)
Robo2XP_038944599.1 IgC_1_Robo 54..152 CDD:409490 23/101 (23%)
Ig strand A 54..58 CDD:409490
Ig strand A' 61..66 CDD:409490
Ig strand B 70..78 CDD:409490 2/7 (29%)
Ig strand C 84..89 CDD:409490 1/4 (25%)
Ig strand C' 92..94 CDD:409490 0/1 (0%)
Ig strand D 105..108 CDD:409490 1/2 (50%)
Ig strand E 111..117 CDD:409490 1/5 (20%)
Ig strand F 129..137 CDD:409490 4/8 (50%)
Ig strand G 140..152 CDD:409490 2/11 (18%)
Ig 159..244 CDD:472250 29/89 (33%)
Ig strand B 173..177 CDD:409353 1/3 (33%)
Ig strand C 187..191 CDD:409353 0/4 (0%)
Ig strand E 209..213 CDD:409353 2/3 (67%)
Ig strand F 223..228 CDD:409353 2/4 (50%)
Ig strand G 237..240 CDD:409353 0/2 (0%)
Ig 251..333 CDD:472250 20/87 (23%)
Ig strand B 265..269 CDD:409353 1/3 (33%)
Ig strand C 278..282 CDD:409353 1/3 (33%)
Ig strand E 299..303 CDD:409353 1/3 (33%)
Ig strand F 313..318 CDD:409353 2/4 (50%)
Ig strand G 326..329 CDD:409353 0/2 (0%)
IgI_4_Robo 342..439 CDD:409391 32/100 (32%)
Ig strand A 342..346 CDD:409391 1/3 (33%)
Ig strand A' 348..352 CDD:409391 0/3 (0%)
Ig strand B 358..366 CDD:409391 3/10 (30%)
Ig strand C 369..376 CDD:409391 2/6 (33%)
Ig strand C' 378..381 CDD:409391 0/2 (0%)
Ig strand D 394..399 CDD:409391 2/4 (50%)
Ig strand E 401..408 CDD:409391 5/6 (83%)
Ig strand F 414..423 CDD:409391 4/8 (50%)
Ig strand G 425..436 CDD:409391 4/10 (40%)
IgI_5_Robo 446..532 CDD:409544 6/85 (7%)
Ig strand A 446..449 CDD:409544 0/2 (0%)
Ig strand A' 453..456 CDD:409544 0/2 (0%)
Ig strand B 462..469 CDD:409544 0/6 (0%)
Ig strand C 475..480 CDD:409544 0/4 (0%)
Ig strand C' 482..484 CDD:409544 0/1 (0%)
Ig strand D 491..495 CDD:409544 2/3 (67%)
Ig strand E 498..503 CDD:409544 0/4 (0%)
FN3 <510..882 CDD:442628 64/287 (22%)
Ig strand F 511..519 CDD:409544 2/7 (29%)
Ig strand G 522..532 CDD:409544 0/9 (0%)
FN3 549..642 CDD:238020 23/98 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.