DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and FCRL4

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_112572.1 Gene:FCRL4 / 83417 HGNCID:18507 Length:515 Species:Homo sapiens


Alignment Length:484 Identity:105/484 - (21%)
Similarity:154/484 - (31%) Gaps:145/484 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LALLAIILLMNISCTSAARDHRRQTNLEAK-----VGSHVVFNCYIDFPFDAPIPYLVHWTKDNK 76
            :.|.|.:|.....|..:|..|:...::...     .|..|...|. .|.|     |....|    
Human     1 MLLWASLLAFAPVCGQSAAAHKPVISVHPPWTTFFKGERVTLTCN-GFQF-----YATEKT---- 55

  Fly    77 KIFTWYEQETSTSELFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHCQVSFPNRSPSVRNNGT 141
               |||.:     ..:..:|.|...         |...:|||  |.|.||.....||..||    
Human    56 ---TWYHR-----HYWGEKLTLTPG---------NTLEVRES--GLYRCQARGSPRSNPVR---- 97

  Fly   142 AYHLAVQGGSLIRIPPVNQTIREGQTAFFHCVMKHPENSQASWYK-DGVLLQEVQDLVRRFYMGP 205
               |.....|||...|  .::.||.|....|..:..|...|..|. :|.:|.         ....
Human    98 ---LLFSSDSLILQAP--YSVFEGDTLVLRCHRRRKEKLTAVKYTWNGNILS---------ISNK 148

  Fly   206 DGSLSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAV-----L 265
            ...|.|.....::.|.|.|.....:.::..:...:   .|.:.::..||:.....||..     |
Human   149 SWDLLIPQASSNNNGNYRCIGYGDENDVFRSNFKI---IKIQELFPHPELKATDSQPTEGNSVNL 210

  Fly   266 DCHF-----RANPPLKNLRWEKDG--LLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYND 323
            .|..     |::.|| :..:.:||  :|.|....|        .|....|...::|||.|.....
Human   211 SCETQLPPERSDTPL-HFNFFRDGEVILSDWSTYP--------ELQLPTVWRENSGSYWCGAETV 266

  Fly   324 LGT-DGPSPVISVIVLRPPIFSV----TPKAIYIQKLGEAAE-----LPCEAIDRDGNNRPSIIW 378
            .|. ...||.:.:.|.|.|:..|    .|..      |:|.|     |.|...:..|:.  :..|
Human   267 RGNIHKHSPSLQIHVQRIPVSGVLLETQPSG------GQAVEGEMLVLVCSVAEGTGDT--TFSW 323

  Fly   379 GRKDGQ---------------PLPADRFSLSGGNLTITGLVEGDRGIYECSATNEAATITAEAEL 428
            .|:|.|               .|||.|.|.:||              |.|:|.|....:    :.
Human   324 HREDMQESLGRKTQRSLRAELELPAIRQSHAGG--------------YYCTADNSYGPV----QS 370

  Fly   429 MIENIAPRAPYNLTANSTETCITIRWQPG 457
            |:.|                 :|:|..||
Human   371 MVLN-----------------VTVRETPG 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 20/90 (22%)
Ig 43..131 CDD:299845 20/92 (22%)
I-set 153..242 CDD:254352 16/89 (18%)
Ig 157..242 CDD:299845 15/85 (18%)
Ig_2 252..337 CDD:290606 23/97 (24%)
IG_like 260..327 CDD:214653 19/79 (24%)
I-set 341..428 CDD:254352 24/110 (22%)
IGc2 356..419 CDD:197706 21/82 (26%)
FN3 435..524 CDD:238020 4/23 (17%)
FN3 554..636 CDD:238020
FCRL4NP_112572.1 Ig1_FcgammaR_like 23..100 CDD:143229 25/112 (22%)
Ig2_FcgammaR_like 105..188 CDD:319307 18/96 (19%)
Ig_2 193..281 CDD:316418 23/96 (24%)
IG_like 295..377 CDD:214653 24/124 (19%)
ITIM motif 1 449..454
ITIM motif 2 461..466
ITIM motif 3 491..496
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 494..515
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.