DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and ROBO3

DIOPT Version :10

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_071765.2 Gene:ROBO3 / 64221 HGNCID:13433 Length:1386 Species:Homo sapiens


Alignment Length:866 Identity:206/866 - (23%)
Similarity:298/866 - (34%) Gaps:238/866 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SRTFRQSGSALLALLAIILLMNISCTSAARDHRRQT--NLEAKVGSHVVFNCYIDFPFDAPIPYL 68
            :|.:..:.::..|.|.:.:|         ||..||:  |:...||...|..|..  |...|.| .
Human   145 ARNYLGAAASRNASLEVAVL---------RDDFRQSPGNVVVAVGEPAVLECVP--PRGHPEP-S 197

  Fly    69 VHWTKDNKKIFTWYEQETSTSELFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHCQVSFPNRS 133
            |.|.||..::    ::|.....:..|:|.:  :|            ..:||.|.|.|..|   ..
Human   198 VSWRKDGARL----KEEEGRITIRGGKLMM--SH------------TLKSDAGMYVCVAS---NM 241

  Fly   134 PSVRNNGTAYHLAVQGGSLIRIPPVNQTIREGQTAFFHCVMKHPENSQASWYK-DGVLLQEVQDL 197
            ...|.:..|..:.::..|.:| .||||.:.......|.|.:|.....:..|.| ||.|      .
Human   242 AGERESAAAEVMVLERPSFLR-RPVNQVVLADAPVTFLCEVKGDPPPRLRWRKEDGEL------P 299

  Fly   198 VRRFYMGPDGSLSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQP 262
            ..|:.:..|.||.|......|.|.|.|...||.|..: |...|::....:::..|.:.....|:.
Human   300 TGRYEIRSDHSLWIGHVSAEDEGTYTCVAENSVGRAE-ASGSLSVHVPPQLVTQPQDQMAAPGES 363

  Fly   263 AVLDCHFRANPPLKNLRWEKDG---LLFDSYNV--PGVF-YKMNGSLFFAKVDENHAGSYTCTPY 321
            ....|..:.||| ..:.|:|:|   |||.|.::  .|.| ....|.|....|....||.|.|...
Human   364 VAFQCETKGNPP-PAIFWQKEGSQVLLFPSQSLQPTGRFSVSPRGQLNITAVQRGDAGYYVCQAV 427

  Fly   322 NDLGT--------------DGPSPVISVIVLRPPIFSVTPKAIYIQKLGEAAELPCEAIDRDGNN 372
            :..|:              ||..|||    |:.|       |.....||.:..|||..   .||.
Human   428 SVAGSILAKALLEIKGASLDGLPPVI----LQGP-------ANQTLVLGSSVWLPCRV---TGNP 478

  Fly   373 RPSIIWGRKDGQPLPADRF---SLSGGNLTITGLVEGDRGIYECSATNEAATITAEAELMIE--- 431
            :||:.| :||||.|..|..   :::.|.|.|..:.|.|.|.|.|.|.:.....|....|.:.   
Human   479 QPSVRW-KKDGQWLQGDDLQFKTMANGTLYIANVQEMDMGFYSCVAKSSTGEATWSGWLKMREDW 542

  Fly   432 NIAPRAPYN-----------LTANSTETCITIRWQPGYLRPNLEYTVWYRLMEA------PEWRT 479
            .::|..|..           :....|:..||:.|:|   .|.....|...::||      ..|||
Human   543 GVSPDPPTEPSSPPGAPSQPVVTEITKNSITLTWKP---NPQTGAAVTSYVIEAFSPAAGNTWRT 604

  Fly   480 LRVLDKKVMEA-TVQHLQPGKEYEFMVLSQDKYG---DGMFSKQFRFQ-TLPSPIRADDFDAQQ- 538
              |.|...:|. ||..|||...|.|:|.:...:|   ....|:..|.| :.||....|.:..|| 
Human   605 --VADGVQLETHTVSGLQPNTIYLFLVRAVGAWGLSEPSPVSEPVRTQDSSPSRPVEDPWRGQQG 667

  Fly   539 -------LQHDLGQVTAP-------------------------AGGLGAPWNLTAIS--NQQGWL 569
                   ||..:  |..|                         ||..|..|.:..:.  :||..:
Human   668 LAEVAVRLQEPI--VLGPRTLQVSWTVDGPVQLVQGFRVSWRVAGPEGGSWTMLDLQSPSQQSTV 730

  Fly   570 LHWEHP---------VQGLEGL---RLYAVR----------------------------WWKEP- 593
            |....|         .||.|||   .|...|                            .|:.| 
Human   731 LRGLPPGTQIQIKVQAQGQEGLGAESLSVTRSIPEEAPSGPPQGVAVALGGDGNSSITVSWEPPL 795

  Fly   594 -----------EHFLIGHAETFD---------NYYQLRHLKEDTLFKVQVLAVGTETQQSVPSHE 638
                       :.:.:|:...|.         ....||.|....|::. ::|..|.....|||..
Human   796 PSQQNGVITEYQIWCLGNESRFHLNRSAAGWARSAMLRGLVPGLLYRT-LVAAATSAGVGVPSAP 859

  Fly   639 LLIDVPS------------------QRKVR--ALIIGSSVGVIFLLCALCAFLYVKRSCLRHL-- 681
            :|:.:||                  .|.:|  |.:.||......||..|||.||.:|...:.|  
Human   860 VLVQLPSPPDLEPGLEVGAGLAVRLARVLREPAFLAGSGAACGALLLGLCAALYWRRKQRKELSH 924

  Fly   682 ----FAKDSSASEDEDTAESG 698
                ||...:.|.......||
Human   925 YTASFAYTPAVSFPHSEGLSG 945

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 21/85 (25%)
Ig strand C 69..72 CDD:409512 1/2 (50%)
Ig strand E 108..112 CDD:409512 0/3 (0%)
Ig strand F 122..127 CDD:409512 2/4 (50%)
Ig 153..242 CDD:472250 27/89 (30%)
Ig strand B 168..172 CDD:409544 1/3 (33%)
Ig strand C 181..185 CDD:409544 0/3 (0%)
Ig strand E 207..211 CDD:409544 2/3 (67%)
Ig strand F 221..226 CDD:409544 2/4 (50%)
Ig strand G 235..238 CDD:409544 1/2 (50%)
Ig_3 247..322 CDD:464046 22/80 (28%)
Ig 341..428 CDD:472250 28/89 (31%)
Ig strand B 359..363 CDD:409353 1/3 (33%)
Ig strand C 375..380 CDD:409353 2/4 (50%)
Ig strand E 396..400 CDD:409353 2/3 (67%)
Ig strand F 410..415 CDD:409353 2/4 (50%)
Ig strand G 423..426 CDD:409353 1/2 (50%)
FN3 435..524 CDD:238020 29/110 (26%)
FN3 554..636 CDD:238020 24/144 (17%)
ROBO3NP_071765.2 Ig 64..162 CDD:472250 3/16 (19%)
Ig strand B 81..85 CDD:409353
Ig strand C 94..98 CDD:409353
Ig strand E 121..125 CDD:409353
Ig strand F 140..145 CDD:409353 206/866 (24%)
Ig strand G 154..157 CDD:409353 0/2 (0%)
Ig 169..254 CDD:472250 26/108 (24%)
Ig strand B 183..187 CDD:409353 1/3 (33%)
Ig strand C 197..201 CDD:409353 1/3 (33%)
Ig strand E 219..223 CDD:409353 2/3 (67%)
Ig strand F 233..238 CDD:409353 2/4 (50%)
Ig strand G 247..250 CDD:409353 0/2 (0%)
Ig 261..343 CDD:472250 27/89 (30%)
Ig strand B 275..279 CDD:409353 1/3 (33%)
Ig strand C 288..292 CDD:409353 0/3 (0%)
Ig strand E 309..313 CDD:409353 2/3 (67%)
Ig strand F 323..328 CDD:409353 2/4 (50%)
Ig strand G 336..339 CDD:409353 1/3 (33%)
Ig 348..445 CDD:472250 23/97 (24%)
Ig strand B 364..368 CDD:409353 0/3 (0%)
Ig strand C 377..381 CDD:409353 0/3 (0%)
Ig strand E 407..411 CDD:409353 2/3 (67%)
Ig strand F 421..426 CDD:409353 2/4 (50%)
Ig strand G 434..437 CDD:409353 0/2 (0%)
Ig 452..536 CDD:472250 31/98 (32%)
Ig strand B 468..472 CDD:409353 1/3 (33%)
Ig strand C 481..485 CDD:409353 2/4 (50%)
Ig strand E 504..508 CDD:409353 2/3 (67%)
FN3 <518..>809 CDD:442628 60/297 (20%)
Ig strand F 518..523 CDD:409353 2/4 (50%)
Ig strand G 531..534 CDD:409353 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 541..563 2/21 (10%)
FN3 556..649 CDD:238020 25/97 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 639..662 6/22 (27%)
FN3 770..863 CDD:238020 14/93 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 965..989
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1028..1310
PRK12323 <1126..1325 CDD:481241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1327..1386
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.