DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and ROBO2

DIOPT Version :10

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_011532283.1 Gene:ROBO2 / 6092 HGNCID:10250 Length:1597 Species:Homo sapiens


Alignment Length:703 Identity:172/703 - (24%)
Similarity:265/703 - (37%) Gaps:136/703 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ALLAIILLMNISCTSAARDHRRQ--TNLEAKVGSHVVFNCYIDFPFDAPIPYLVHWTKDNKKIFT 80
            |.|.:.||         ||..||  |::....|...:..|  ..|...|.| .::|.||..:|  
Human   147 ASLEVALL---------RDDFRQNPTDVVVAAGEPAILEC--QPPRGHPEP-TIYWKKDKVRI-- 197

  Fly    81 WYEQETSTSELFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHCQVSFPNRSPSVRNNGTAYHL 145
              :.:.....:..|:| ::.|             .|:||.|.|.|   ........|::..|...
Human   198 --DDKEERISIRGGKL-MISN-------------TRKSDAGMYTC---VGTNMVGERDSDPAELT 243

  Fly   146 AVQGGSLIRIPPVNQTIREGQTAFFHCVMKHPENSQASWYKDGVLLQEVQDLVR-RFYMGPDGSL 209
            ..:..:.:| .|:||.:.|.:...|.|.::........|.||..      ||.| |:.:..|.:|
Human   244 VFERPTFLR-RPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDDA------DLPRGRYDIKDDYTL 301

  Fly   210 SIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYK----AKVIYAPPEVFLPYGQPAVLDCHFR 270
            .|..||.:|.|.|.|...|..|::: |.|.|.::.:    .:.:..|.:..:..|:.....|..:
Human   302 RIKKTMSTDEGTYMCIAENRVGKME-ASATLTVRARPVAPPQFVVRPRDQIVAQGRTVTFPCETK 365

  Fly   271 ANPPLKNLRWEKDG---LLFDSYNVP-----GVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGT- 326
            .||. ..:.|:|:|   |||.  |.|     .......|.|....:..:.||.|.|......|: 
Human   366 GNPQ-PAVFWQKEGSQNLLFP--NQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSI 427

  Fly   327 --DGPSPVISVIVLRPPIFSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQPLPA- 388
              .....|..|:..|||...:...|.....:...|.|.|:|   .|:..|.|.| .|:|...|. 
Human   428 LAKAQLEVTDVLTDRPPPIILQGPANQTLAVDGTALLKCKA---TGDPLPVISW-LKEGFTFPGR 488

  Fly   389 -DRFSL-SGGNLTITGLVEGDRGIYECSATNEA---------------ATITAEAELMIENIAPR 436
             .|.:: ..|.|.|..|...|.|.|.|.||:.:               |||:...:|......|.
Human   489 DPRATIQEQGTLQIKNLRISDTGTYTCVATSSSGETSWSAVLDVTESGATISKNYDLSDLPGPPS 553

  Fly   437 APY--NLTANSTETCITIRWQPG---------YLRPNLEYTVWYRLMEAPEWRTLRVLDKKVMEA 490
            .|.  ::|.||    :|:.||||         |:......:|      :..|:|:....|..: .
Human   554 KPQVTDVTKNS----VTLSWQPGTPGTLPASAYIIEAFSQSV------SNSWQTVANHVKTTL-Y 607

  Fly   491 TVQHLQPGKEYEFMVLSQDKYG---DGMFSKQFRFQTLPSPIRADDFDAQQLQHDLGQVTAPAGG 552
            ||:.|:|...|.|||.:.:..|   ....|...|.|.:..|  |...|.:|:|.:||.|..   .
Human   608 TVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQDISPP--AQGVDHRQVQKELGDVLV---R 667

  Fly   553 LGAPWNLTAISNQQGWLLHWEHPVQGLEGLR--------LYAVRWWKEPEHFLIGHAETFDNYYQ 609
            |..|..||..:.|..|.:  :...|.::|.|        |.|...|:.    |.....| :....
Human   668 LHNPVVLTPTTVQVTWTV--DRQPQFIQGYRVMYRQTSGLQATSSWQN----LDAKVPT-ERSAV 725

  Fly   610 LRHLKEDTLFKVQVLAVGTETQ------QSVPSHELLIDVPSQRKVRALIIGS 656
            |.:||:...::::|.....|.|      ::|.:.|.....|.| .|..|.:||
Human   726 LVNLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEEAPSAPPQ-SVTVLTVGS 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 18/85 (21%)
Ig strand C 69..72 CDD:409512 0/2 (0%)
Ig strand E 108..112 CDD:409512 0/3 (0%)
Ig strand F 122..127 CDD:409512 2/4 (50%)
Ig 153..242 CDD:472250 28/89 (31%)
Ig strand B 168..172 CDD:409544 1/3 (33%)
Ig strand C 181..185 CDD:409544 0/3 (0%)
Ig strand E 207..211 CDD:409544 1/3 (33%)
Ig strand F 221..226 CDD:409544 2/4 (50%)
Ig strand G 235..238 CDD:409544 1/2 (50%)
Ig_3 247..322 CDD:464046 19/82 (23%)
Ig 341..428 CDD:472250 27/104 (26%)
Ig strand B 359..363 CDD:409353 2/3 (67%)
Ig strand C 375..380 CDD:409353 2/4 (50%)
Ig strand E 396..400 CDD:409353 2/3 (67%)
Ig strand F 410..415 CDD:409353 2/4 (50%)
Ig strand G 423..426 CDD:409353 0/2 (0%)
FN3 435..524 CDD:238020 26/102 (25%)
FN3 554..636 CDD:238020 20/95 (21%)
ROBO2XP_011532283.1 IgC_1_Robo 54..152 CDD:409490 2/4 (50%)
Ig strand A 54..58 CDD:409490
Ig strand A' 61..66 CDD:409490
Ig strand B 70..78 CDD:409490
Ig strand C 84..89 CDD:409490
Ig strand C' 92..94 CDD:409490
Ig strand D 105..108 CDD:409490
Ig strand E 111..117 CDD:409490
Ig strand F 129..137 CDD:409490
Ig strand G 140..152 CDD:409490 2/4 (50%)
Ig 159..244 CDD:472250 23/108 (21%)
Ig strand B 173..177 CDD:409353 0/3 (0%)
Ig strand C 187..191 CDD:409353 0/3 (0%)
Ig strand E 209..213 CDD:409353 2/4 (50%)
Ig strand F 223..228 CDD:409353 2/7 (29%)
Ig strand G 237..240 CDD:409353 0/2 (0%)
Ig 251..333 CDD:472250 28/89 (31%)
Ig strand B 265..269 CDD:409353 1/3 (33%)
Ig strand C 278..282 CDD:409353 0/3 (0%)
Ig strand E 299..303 CDD:409353 1/3 (33%)
Ig strand F 313..318 CDD:409353 2/4 (50%)
Ig strand G 326..329 CDD:409353 1/3 (33%)
IgI_4_Robo 342..439 CDD:409391 21/99 (21%)
Ig strand A 342..346 CDD:409391 0/3 (0%)
Ig strand A' 348..352 CDD:409391 0/3 (0%)
Ig strand B 358..366 CDD:409391 1/7 (14%)
Ig strand C 369..376 CDD:409391 1/7 (14%)
Ig strand C' 378..381 CDD:409391 1/2 (50%)
Ig strand D 394..399 CDD:409391 0/4 (0%)
Ig strand E 401..408 CDD:409391 2/6 (33%)
Ig strand F 414..423 CDD:409391 3/8 (38%)
Ig strand G 425..436 CDD:409391 1/10 (10%)
IgI_5_Robo 446..532 CDD:409544 23/89 (26%)
Ig strand A 446..449 CDD:409544 0/2 (0%)
Ig strand A' 453..456 CDD:409544 0/2 (0%)
Ig strand B 462..469 CDD:409544 4/9 (44%)
Ig strand C 475..480 CDD:409544 2/5 (40%)
Ig strand C' 482..484 CDD:409544 1/1 (100%)
Ig strand D 491..495 CDD:409544 1/3 (33%)
Ig strand E 498..503 CDD:409544 2/4 (50%)
FN3 <510..882 CDD:442628 72/292 (25%)
Ig strand F 511..519 CDD:409544 4/7 (57%)
Ig strand G 522..532 CDD:409544 0/9 (0%)
FN3 549..642 CDD:238020 25/103 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.