DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and Myot

DIOPT Version :10

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_006526194.1 Gene:Myot / 58916 MGIID:1889800 Length:497 Species:Mus musculus


Alignment Length:531 Identity:105/531 - (19%)
Similarity:185/531 - (34%) Gaps:120/531 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ILLMNISCTSAARDHRRQTNLEAKVGSHVVF--NCYIDFPFDAPIPYLVHWTKDNKKIFTWYEQE 85
            |::....||      .::.:..:.|.||:..  :.|       |.|..:......:|:...|.| 
Mouse    40 IVIQPRQCT------EQRFSASSTVSSHITVSSSAY-------PAPQQLAGPNPGQKVTATYNQ- 90

  Fly    86 TSTSELFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHCQVSFP---------NRSPSVRNNGT 141
             |.:...:.   ::.:.|::..:.:..|.    |..:....|:.|         |..|:.:   |
Mouse    91 -SPASFLSS---ILPSQPDYCNSKIPSTV----DSNYQQSSVNQPVNAMSSQAANARPTPK---T 144

  Fly   142 AYHLAVQGGSLIRIPPVNQTIREGQTAFFHCVMKHPENSQASWYKDGVLLQEVQDLVRRFYMGPD 206
            ..| .:||.....|..:.:.::...|      :.|..|.:.::          ::.:.|..:||.
Mouse   145 PDH-EIQGSKEALIQDLERKLKCKDT------LLHNGNQRLTY----------EEKMARRLLGPQ 192

  Fly   207 GSLSIDPTMMSDLGEY--------------ECKVR---NSDGELQTAKAFLNIQYKAKVIYAPPE 254
            .:.::.....||:.:.              ..:||   :|..|.....|.....|..:.|..|..
Mouse   193 NAAAVFQAQNSDVQDSPQQHNPEQARLHVPTSQVRSRSSSRAEANDQDAIQEKFYPPRFIQVPEN 257

  Fly   255 VFLPYGQPAVLDCHFRANP-PLKNLRWEKDGLLFDSYNVPGVFYKMNG--SLFFAKVDENHAGSY 316
            :.:..|:...:|  |:.:. |..::.|..:|....|..:..:.....|  ||.|..|..:.||.|
Mouse   258 MSIEEGRFCRMD--FKVSGLPAPDVSWYLNGRPVQSDELHKMIVSEKGFHSLIFEVVRASDAGPY 320

  Fly   317 TCTPYNDLGTDGPSPVISVIV---LRPPIFSVTPKAIYIQKLGEAAELPCE--AIDRDGNNRPSI 376
            .|...|..|....:..:.|:.   .|.|:|...|::..:.: ||..:|.|:  ||.     .|.:
Mouse   321 ACVARNRAGEATFTVQLDVLAKEHKRAPMFIFKPQSKKVFE-GETVKLECQISAIP-----PPKL 379

  Fly   377 IWGRKDGQ-PLPADRFSLSGGN-----LTITGLVEGDRGIYECSATNEAATITAEAELMIENIAP 435
            .|.|.:.. ....||.||...|     |.|..:.:.|.|.|..||.|||...|....|       
Mouse   380 FWKRNNEMVQFNTDRISLYHDNAGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRL------- 437

  Fly   436 RAPYNLTANSTETCITIRWQPGYLRPNLEYTVWYRLMEAPEWRTLRVLDKKVMEATVQHLQPGKE 500
                ::||...:|...    |..||....::.:..|       ..|.||.|      |...|..|
Mouse   438 ----DVTARPIQTLPA----PKQLRVRPTFSKYLAL-------NGRGLDVK------QAFNPEGE 481

  Fly   501 YEFMVLSQDKY 511
            ::.:......|
Mouse   482 FQRLAAQSGLY 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 13/87 (15%)
Ig strand C 69..72 CDD:409512 0/2 (0%)
Ig strand E 108..112 CDD:409512 0/3 (0%)
Ig strand F 122..127 CDD:409512 0/4 (0%)
Ig 153..242 CDD:472250 14/105 (13%)
Ig strand B 168..172 CDD:409544 0/3 (0%)
Ig strand C 181..185 CDD:409544 0/3 (0%)
Ig strand E 207..211 CDD:409544 0/3 (0%)
Ig strand F 221..226 CDD:409544 0/18 (0%)
Ig strand G 235..238 CDD:409544 0/2 (0%)
Ig_3 247..322 CDD:464046 18/77 (23%)
Ig 341..428 CDD:472250 28/94 (30%)
Ig strand B 359..363 CDD:409353 1/3 (33%)
Ig strand C 375..380 CDD:409353 1/4 (25%)
Ig strand E 396..400 CDD:409353 2/8 (25%)
Ig strand F 410..415 CDD:409353 1/4 (25%)
Ig strand G 423..426 CDD:409353 1/2 (50%)
FN3 435..524 CDD:238020 15/77 (19%)
FN3 554..636 CDD:238020
MyotXP_006526194.1 Ig 249..339 CDD:472250 20/91 (22%)
Ig strand B 266..270 CDD:409353 1/5 (20%)
Ig strand C 279..283 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 2/3 (67%)
Ig strand F 319..324 CDD:409353 2/4 (50%)
Ig strand G 332..335 CDD:409353 0/2 (0%)
IgI_Myotilin_C 348..439 CDD:409473 29/107 (27%)
Ig strand A 348..351 CDD:409473 1/2 (50%)
Ig strand A' 354..359 CDD:409473 1/4 (25%)
Ig strand B 364..371 CDD:409473 2/6 (33%)
Ig strand C 378..384 CDD:409473 1/5 (20%)
Ig strand C' 385..388 CDD:409473 0/2 (0%)
Ig strand D 395..401 CDD:409473 2/5 (40%)
Ig strand E 404..414 CDD:409473 2/9 (22%)
Ig strand F 418..426 CDD:409473 4/7 (57%)
Ig strand G 428..439 CDD:409473 3/21 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.