DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and DIP-delta

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:503 Identity:103/503 - (20%)
Similarity:177/503 - (35%) Gaps:143/503 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ILLMNISCTSAARDHRR------QTNLEAKVGSHVVFNCYIDFP-FDAPIP-------------- 66
            :||:.::...:...:||      .|||.    :||:    :|.| |..|||              
  Fly     9 LLLIALNIFPSRFTNRRIMFLIYMTNLV----THVM----MDEPRFAQPIPNVTVAVGRDANLPC 65

  Fly    67 -------YLVHWTK-DNKKIFTWYEQETSTSELFNGRLHLVENHPEFGRASVNLTAI------RE 117
                   |.|.|.. |.:.|.|.:.             |::...|.:.....:.|.:      .:
  Fly    66 VVEHLGGYKVAWIHIDRQMILTIHR-------------HVISRIPRYSITYTDNTWLLHVNQAHQ 117

  Fly   118 SDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGGSLIRI--PPVNQTIREGQTAFFHCVMKHPENS 180
            .|:|:|.|||   |.:|.:...|  |...|...:::.|  .|.:..:||.|.....|........
  Fly   118 DDRGYYMCQV---NTNPMISQVG--YLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGFPAP 177

  Fly   181 QASWYK-DGVLLQEVQDLVRRFYMGPDGS-LSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQ 243
            :..|.: ||   :|:....::..:..|.. |.:.....:::|.|.|...|......:.:..|:::
  Fly   178 KIIWRREDG---EEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVE 239

  Fly   244 YKAKVIYAPPE-VFLPYGQPAVLDCHFRANPPLKNLRWEKDGLLFDSYN----VPGVFYKMNGS- 302
            : :.:|:.|.: |..|.|....:|||..|:|         ..:::..||    :|...||.:.: 
  Fly   240 F-SPMIWVPNQLVGAPSGTDVTIDCHTEAHP---------KAIIYWVYNSVMVLPSKKYKTDYTE 294

  Fly   303 --------LFFAKVDENHAGSYTCTPYNDLG-TDGPSPVISVIVLRPPIFSVTPKAIYIQKLGEA 358
                    |....:.....|:|.|...|.|| |:|...|..:.:...|...||...:.       
  Fly   295 NSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPSKQVTHTTVE------- 352

  Fly   359 AELPCEAIDRDGNNRPSIIWGRKD---------GQPLPADRF------SLSGGNLTI-------- 400
                    .|:.|..||   .|.|         |..:..|.:      |.|||:.:.        
  Fly   353 --------SRENNIIPS---SRNDTTKSLQTDVGYAMKNDLYPGSASSSSSGGSSSAASSSSSMQ 406

  Fly   401 TGLVEGDRGIYECSATNEAATITAEAELMIEN---IAPRAPYNLTANS 445
            |..:.|  |:    |.|..:::.::..|.|..   ...|.|....|:|
  Fly   407 TSALPG--GV----AGNSLSSMGSKGSLAIGKSTFYTERPPNEYAASS 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 24/114 (21%)
Ig 43..131 CDD:299845 24/116 (21%)
I-set 153..242 CDD:254352 17/92 (18%)
Ig 157..242 CDD:299845 16/86 (19%)
Ig_2 252..337 CDD:290606 24/99 (24%)
IG_like 260..327 CDD:214653 18/80 (23%)
I-set 341..428 CDD:254352 20/109 (18%)
IGc2 356..419 CDD:197706 17/85 (20%)
FN3 435..524 CDD:238020 4/11 (36%)
FN3 554..636 CDD:238020
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 20/109 (18%)
Ig 145..238 CDD:416386 17/95 (18%)
Ig strand A 145..149 CDD:409353 0/3 (0%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 2/4 (50%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 1/7 (14%)
Ig 242..333 CDD:416386 24/99 (24%)
Ig strand A' 250..253 CDD:409353 1/2 (50%)
Ig strand B 259..266 CDD:409353 3/6 (50%)
Ig strand C 272..277 CDD:409353 0/4 (0%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 1/9 (11%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.