DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and CG34353

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:479 Identity:94/479 - (19%)
Similarity:159/479 - (33%) Gaps:124/479 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 GQTAFFHCVMKHPENSQASWYKDGVLLQEVQD----------LVRRFYMGPDGSLSIDPTMMSDL 219
            |:|....|.:.:.:....:| |.|:.:.....          ||..|      :|.|...:.:|.
  Fly   100 GETIVLPCEVANTDTYVVAW-KRGIAILTAGSVKVTPDPRVRLVNGF------NLQIRDALPTDA 157

  Fly   220 GEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVF---------LPYGQPAVLDCHFRANPPL 275
            |:|.|::...|..        .|.:..::: .||.:.         :..|....::|....| |:
  Fly   158 GDYICQIATMDPR--------EITHTVEIL-VPPRIHHISTGGHLQVKKGSSVRIECSATGN-PM 212

  Fly   276 KNLRW-EKDGLLFDSYNVPGVFYKMNGS-LFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVL 338
            .|:.| .|:.:|      |....|::.. |....||.:..|.|.||..|.:|....|.|:..::.
  Fly   213 PNVTWSRKNNIL------PNGEEKLHSHVLSIENVDRHKGGVYICTANNRVGQPASSQVVLHVLF 271

  Fly   339 RPPIFSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQPLPADRFSL----SGGNLT 399
            .|.| ||....::..: |..|.|.|..   .|..:|.:||.:...|....:|..:    |...|.
  Fly   272 SPEI-SVERPVVFSGE-GHEATLVCIV---HGETQPEVIWFKDTMQLDTTERHIMETRGSRHTLI 331

  Fly   400 ITGLVEGDRGIYECSATNE------AATITAEAELMIENIAPRAPYNLTANSTETCITIRWQPGY 458
            |..:...|.|.|.|.|.|:      ...::.:..:.:.|..|.:.|....|       |.|....
  Fly   332 IRKVHPQDFGNYSCVAENQLGKARKTLQLSGKPNVAVFNSPPISQYKDRYN-------ISWAVDS 389

  Fly   459 LRPNLEYTVWYRLMEAPEWRTLRVLDKKVMEATVQHLQPGKEYEFMVLSQDKYGDGMFSKQFRFQ 523
            ..|..||.:.:|.:..........:|.....:::..           .|...||.|:.:      
  Fly   390 HSPIEEYKLSFRKLPQGHEVVGNAIDSSSSSSSMSS-----------SSSQMYGSGLHA------ 437

  Fly   524 TLPSPIRADDFDAQQLQHDLGQVTAPAGGLGAPWNLTAISNQQGWLLHWEH-----------PV- 576
                             |.:|.......||....:.:...|    ::||.|           || 
  Fly   438 -----------------HRIGSNMGGLSGLSGSGSYSGYGN----VIHWGHNDWRNVVLPAVPVS 481

  Fly   577 ----QGLEGLRLYAVRWWKEPEHF 596
                ||:.    |.||.....:|:
  Fly   482 HHYAQGMS----YMVRGLDPDQHY 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 16/86 (19%)
Ig 157..242 CDD:299845 16/86 (19%)
Ig_2 252..337 CDD:290606 23/95 (24%)
IG_like 260..327 CDD:214653 19/68 (28%)
I-set 341..428 CDD:254352 22/96 (23%)
IGc2 356..419 CDD:197706 19/72 (26%)
FN3 435..524 CDD:238020 14/88 (16%)
FN3 554..636 CDD:238020 12/59 (20%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 17/95 (18%)
Ig 103..177 CDD:143165 15/88 (17%)
IG_like 191..269 CDD:214653 21/84 (25%)
IGc2 198..258 CDD:197706 18/66 (27%)
I-set 273..360 CDD:254352 23/91 (25%)
Ig 290..359 CDD:143165 18/71 (25%)
FN3 <466..524 CDD:238020 9/40 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.