DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and cntn3a.1

DIOPT Version :10

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_697914.4 Gene:cntn3a.1 / 569437 ZFINID:ZDB-GENE-081030-10 Length:1028 Species:Danio rerio


Alignment Length:583 Identity:133/583 - (22%)
Similarity:221/583 - (37%) Gaps:134/583 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GSHVVFNCYIDFPFDAPIPYLVHWTKDN-----KKIFTWYEQETSTSELFNGRLHLVENHPEFGR 107
            |..|...|   |....|:| .:.|.:.:     :|:      :.|.|   :|.|.:    |.|  
Zfish   244 GLTVKLEC---FALGNPVP-AISWRRPDGVPFPRKV------DVSKS---SGVLEI----PYF-- 289

  Fly   108 ASVNLTAIRESDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGGSLIRIPP--------VNQTIRE 164
                    ::.|.|.|.| |:..:|.   :|.|       :|......||        |.:.|.|
Zfish   290 --------QQEDAGPYEC-VAENSRG---KNTG-------KGRLSFYAPPHLVEKPQDVQRAIDE 335

  Fly   165 GQTAFFHCVMKHPENSQASWYKDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMSDLGEYECKVRNS 229
              :..:.|...........|.|:|..|:..:|.::..    :|:|||....:||.|.|:|...|.
Zfish   336 --SLLWECKASAKPKPSYRWLKNGEPLESFEDRIQVI----NGALSISSLTLSDTGMYQCIAENR 394

  Fly   230 DGELQTAKAFLNIQYKAKVIYAP--------PEVFLPYGQPAVLDCHFRANPPLKNLRWEK-DGL 285
            .|     :.|.|.:.:. :..||        .:.....|...:::|..|.: |...:.|.| ...
Zfish   395 HG-----RVFANAELRV-IAVAPDFSNSVLKAQTLARQGGDVLIECRPRMS-PRGMISWRKGKEA 452

  Fly   286 LFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIFSVTPKAI 350
            |.:|:.|..:   .||||..:.:.:..||.|||...|..|.  .|...:::|..|.|  :|.||.
Zfish   453 LRESHRVSVL---DNGSLRISNITKLDAGLYTCVARNQFGV--ASSAGTLVVKEPTI--ITSKAT 510

  Fly   351 YIQ-KLGEAAELPCEAIDRDGN---------NRPSIIWGRKDGQPLPADRF----SLSGGNLTIT 401
            .:. .:||:..:||: :.||.:         |...|.:|...|.      |    ..|.|::.|.
Zfish   511 QLDVTVGESVVIPCQ-VSRDPSLDVRFTWFFNEQLINFGSHGGY------FEKVGGASAGDIMIR 568

  Fly   402 GLVEGDRGIYECSATNEAATITAEAELMIENIAPRAPYNLTANS-TETCITIRWQPG--YLRPNL 463
            .:.....|.|.|:...:..:.:...::::.. .|..|.::..:. |||...:.|.||  ...|..
Zfish   569 NIQLRHAGRYTCAVQTKVDSASIATDVVVRG-PPDPPLDIRVDEVTETTSFVSWSPGPDNHSPVF 632

  Fly   464 EYTVWYRLMEAPEWRTLRVLDKKV----MEATVQHLQPGKEYEFMVLSQDKYGDG---MFSKQFR 521
            .|.:..|...:..|:..:.:.:.:    ..|.|..|.|..||||.||:.:..|.|   ..|::.|
Zfish   633 AYNIQIRSPFSLGWQAAKTVPESLGGQQSSARVVELSPWVEYEFRVLATNSIGTGEPTKPSQKIR 697

  Fly   522 FQ-TLP--SPIRADDF---------------DAQQLQHDLGQVTA--PAGGLGAPWNLTAISN 564
            .: |:|  :|.|....               :.||.....|.|.|  |.||..  |...|:::
Zfish   698 TKDTMPRITPARVSGGGGSRSELVITWEPVPEEQQAGPGFGYVVAFRPLGGQN--WMQAAVTS 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 18/84 (21%)
Ig strand C 69..72 CDD:409512 0/2 (0%)
Ig strand E 108..112 CDD:409512 0/3 (0%)
Ig strand F 122..127 CDD:409512 2/4 (50%)
Ig 153..242 CDD:472250 23/96 (24%)
Ig strand B 168..172 CDD:409544 0/3 (0%)
Ig strand C 181..185 CDD:409544 0/3 (0%)
Ig strand E 207..211 CDD:409544 2/3 (67%)
Ig strand F 221..226 CDD:409544 2/4 (50%)
Ig strand G 235..238 CDD:409544 0/2 (0%)
Ig_3 247..322 CDD:464046 20/83 (24%)
Ig 341..428 CDD:472250 21/100 (21%)
Ig strand B 359..363 CDD:409353 0/3 (0%)
Ig strand C 375..380 CDD:409353 1/4 (25%)
Ig strand E 396..400 CDD:409353 1/3 (33%)
Ig strand F 410..415 CDD:409353 2/4 (50%)
Ig strand G 423..426 CDD:409353 0/2 (0%)
FN3 435..524 CDD:238020 26/99 (26%)
FN3 554..636 CDD:238020 2/11 (18%)
cntn3a.1XP_697914.4 FN3 808..901 CDD:238020
FN3 916..994 CDD:238020
Ig 26..122 CDD:472250
Ig strand B 48..52 CDD:409353
Ig strand C 61..65 CDD:409353
Ig strand E 84..88 CDD:409353
Ig strand F 99..104 CDD:409353
Ig strand G 113..116 CDD:409353
Ig 131..217 CDD:472250
Ig strand B 142..146 CDD:409353
Ig strand C 156..160 CDD:409353
Ig strand E 181..185 CDD:409353
Ig strand F 195..200 CDD:409353
Ig strand G 211..214 CDD:409353
Ig 229..317 CDD:472250 23/110 (21%)
Ig strand B 247..251 CDD:409353 1/3 (33%)
Ig strand C 260..264 CDD:409353 0/3 (0%)
Ig strand E 282..286 CDD:409353 2/3 (67%)
Ig strand F 296..301 CDD:409353 2/5 (40%)
Ig strand G 309..312 CDD:409353 1/9 (11%)
Ig 323..406 CDD:472250 22/93 (24%)
Ig strand B 337..341 CDD:143205 0/3 (0%)
Ig strand C 350..354 CDD:143205 0/3 (0%)
Ig strand E 372..376 CDD:143205 2/3 (67%)
Ig strand F 386..391 CDD:143205 2/4 (50%)
Ig strand G 399..402 CDD:143205 1/2 (50%)
Ig 411..499 CDD:472250 22/93 (24%)
Ig strand B 430..434 CDD:409353 0/3 (0%)
Ig strand C 443..447 CDD:409353 0/3 (0%)
Ig strand E 465..469 CDD:409353 3/3 (100%)
Ig strand F 479..484 CDD:409353 3/4 (75%)
Ig strand G 492..495 CDD:409353 1/2 (50%)
Ig 501..601 CDD:472250 22/109 (20%)
Ig strand B 520..524 CDD:409353 0/3 (0%)
Ig strand C 535..539 CDD:409353 0/3 (0%)
Ig strand E 563..567 CDD:409353 1/3 (33%)
Ig strand F 577..582 CDD:409353 2/4 (50%)
Ig strand G 590..593 CDD:409353 0/2 (0%)
FN3 601..698 CDD:238020 25/96 (26%)
FN3 707..799 CDD:238020 12/54 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.