DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and paplna

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_005169942.1 Gene:paplna / 562930 ZFINID:ZDB-GENE-070815-4 Length:1187 Species:Danio rerio


Alignment Length:411 Identity:89/411 - (21%)
Similarity:149/411 - (36%) Gaps:94/411 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IRESDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGGSLIRIPPVNQTIREGQTAFFHCVMKHPEN 179
            ::.|..|.:..|.:....|.:::.:..|.....:|.|:.:..|.......||.....|.:..|.:
Zfish   797 VQLSSSGAHRAQRAHQPASNAMQQSNPAASWTAEGVSIDKTDPSTVEGLVGQRVVLPCRVTPPPS 861

  Fly   180 SQ--ASWYKDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMSDLGEYECKVRNSD------------ 230
            |.  ..|.:|||.:...     |.....||||.:.|..:.|.|.:.|.....|            
Zfish   862 SAVLVEWRRDGVPVDPT-----RHEQQLDGSLLVGPITLQDSGWFLCVATRDDKRDHRYIYLSVS 921

  Fly   231 ---------GELQTAKAF-------LNIQYKAKVIYAPPEVFLPYGQPAVLDC------------ 267
                     .|:.:::::       .||.|.       |.|....||.|.|.|            
Zfish   922 GSSQNNAGISEVDSSQSYTSQSSSRFNIDYS-------PLVEARAGQTAKLQCSVLPVSAIHAVT 979

  Fly   268 -HF-RANPPLKNLRWEKDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGTDG-- 328
             |: ||..||.:||..:..               :|:|...::..:.:|.||||.     ||.  
Zfish   980 IHWSRAGQPLNSLRHSQHS---------------DGTLVIKQLTADDSGLYTCTV-----TDAQK 1024

  Fly   329 -PSPVISVIVLRPPIFSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQPLPAD--R 390
             ....:.:.||.....:..|..:.:.: |..|:|.|.....:.|    :.|.| :|.|:..|  |
Zfish  1025 FEERQVQLRVLGDLRITKAPIDVDVVQ-GSTAQLACVVTGENVN----VGWSR-NGVPVRPDGHR 1083

  Fly   391 FSLSG-GNLTITGLVEGDRGIYECSATNEAATITAEAELMIENIAPRAPYNLTANSTETCITIRW 454
            ..:|. |.|.:..:...|.|.|.|:|.....:::|.||:.:.. .|:...:....|:..|:.   
Zfish  1084 VHVSADGTLILNNVQSVDEGTYTCNAYTGTLSVSAAAEIRLAK-TPQQDIDGGQFSSSDCVD--- 1144

  Fly   455 QPGYLRPNLEYTVWYRLMEAP 475
            ||..  .|.:..|:.||..:|
Zfish  1145 QPEL--ANCKLIVYARLCSSP 1163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 3/12 (25%)
Ig 43..131 CDD:299845 3/15 (20%)
I-set 153..242 CDD:254352 21/118 (18%)
Ig 157..242 CDD:299845 21/114 (18%)
Ig_2 252..337 CDD:290606 23/101 (23%)
IG_like 260..327 CDD:214653 19/80 (24%)
I-set 341..428 CDD:254352 22/89 (25%)
IGc2 356..419 CDD:197706 19/65 (29%)
FN3 435..524 CDD:238020 10/41 (24%)
FN3 554..636 CDD:238020
paplnaXP_005169942.1 TSP1 24..75 CDD:214559
ADAM_spacer1 181..293 CDD:310520
TSP1 303..356 CDD:214559
TSP1 388..442 CDD:214559
TSP1 449..498 CDD:214559
TSP1 504..557 CDD:214559
KU 720..771 CDD:238057
Ig_3 839..906 CDD:316449 19/71 (27%)
IGc2 960..1022 CDD:197706 20/81 (25%)
I-set 1039..1121 CDD:333254 21/87 (24%)
PLAC 1142..1173 CDD:312271 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.