DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and NCAM2

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_011527877.1 Gene:NCAM2 / 4685 HGNCID:7657 Length:874 Species:Homo sapiens


Alignment Length:723 Identity:158/723 - (21%)
Similarity:262/723 - (36%) Gaps:159/723 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EAKVGSHVVFNCYIDFPFDAPIPYLVHWTKDNKKIFTWYEQETSTSELFNGRLHLVENHPEFGRA 108
            |.|.|......|.:.   .:|.| .|.|...|:::.|          :.:.|..::.|:      
Human   150 EFKQGEDAEVVCRVS---SSPAP-AVSWLYHNEEVTT----------ISDNRFAMLANN------ 194

  Fly   109 SVNLTAIRESDQGWYHCQVSFPNRSP-SVRNNGTAYHLAVQGGSLIRIPPV--------NQTIRE 164
            ::.:..|.:||:|.|.|:.....|.. ..|:      :.|    ::.:||.        |.|...
Human   195 NLQILNINKSDEGIYRCEGRVEAR
GEIDFRD------IIV----IVNVPPAISMPQKSFNATAER 249

  Fly   165 GQTAFFHCVMKHPENSQASWYKDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMSDLGEYECKVRNS 229
            |:...|.|..........||:::|.|::|.:..:.:   |.:..|::...:.||.|.|.|:..|.
Human   250 GEEMTFSCRASGSPEPAISWFRNGKLIEENEKYILK---GSNTELTVRNIINSDGGPYVCRATNK 311

  Fly   230 DGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPLKNLRWEK--DGLLFDS--- 289
            .|| ...:|||.:..:..:|....|.....|| ..|.|..... |:..:.|::  ||..|..   
Human   312 AGE-DEKQAFLQVFVQPHIIQLKNETTYENGQ-VTLVCDAEGE-PIPEITWKRAVDGFTFTEGDK 373

  Fly   290 -----YNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIFSVTPKA 349
                 ..|.|  ...:.||....|..:.:|.|.|...:.:|  |....:.:.:...|.| ::.:.
Human   374 SLDGRIEVKG--QHGSSSLHIKDVKLSDSGRYDCEAASRIG--GHQKSMYLDI
EYAPKF-ISNQT 433

  Fly   350 IYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQPLPADRF----SLSGGN---LTITGLVEGD 407
            ||....|....:.|:.    .:|.|:.|..|:|...|||...    :.|.|.   |.|....:.|
Human   434 IYYSWEGNPINISCDV----KSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDND 494

  Fly   408 RGIYECSATNEAATITAEAELMIENIAPRAPYNL-TANSTETCITIRWQPGYLRPNL-------E 464
            .|.|.|:|||...|...|..|.:.:: |.:||.: ....::|...:    .:.:|:.       .
Human   495 FGRYNCTATNHIGTRFQEYILALADV-PSSPYGVKIIELSQTTAKV----SFNKPDSHGGVPIHH 554

  Fly   465 YTVWYRLMEAPEWRTLRVLDKKVMEATVQHLQPGKEYEFMVLSQDKYGDGMFSKQFRFQTLP--- 526
            |.|..:.:.:..|:.:|....:.| ..:.:|:|...||..|.:.:..|.|.:||...|||||   
Human   555 YQVDVKEVASEIWKIVRSHGVQTM-VVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVRE 618

  Fly   527 --------SPIRADDFDAQQLQHDLGQVTAPAGGLGAP-----WNLTAISNQQGWLLHWEHPVQG 578
                    .|.....|.....:.|.|         |||     ....:...:..||   |..|||
Human   619 PSPPSIHGQPSSGKSFKLSITKQDDG---------GAPILEYIVKYRSKDKEDQWL---EKKVQG 671

  Fly   579 LEGLRLYAVRWWKEPEHFLIGHAETFDNYYQLRHLKEDTLFKVQVLAVG-------TETQQSVPS 636
                         ..:|.:            |.||:....::||:.|..       |..:.|:|.
Human   672 -------------NKDHII------------LEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPP 711

  Fly   637 HELLI-DVPSQRKVRALIIGSSVGVIFLLCAL----CAFLYVKRSC------LRHLFAKDSSASE 690
            ...:| |..........:||..|..:.|:..:    |.|:   |.|      .|.:..|.|.:|.
Human   712 KPNIIKDTLFNGLGLGAVIGLGVAALLLILVVTDVSCFFI---RQCGLLMCITRRMCGKKSGSSG 773

  Fly   691 DEDTAESG 698
            .....|.|
Human   774 KSKELEEG 781

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 18/83 (22%)
Ig 43..131 CDD:299845 18/86 (21%)
I-set 153..242 CDD:254352 25/96 (26%)
Ig 157..242 CDD:299845 24/92 (26%)
Ig_2 252..337 CDD:290606 20/94 (21%)
IG_like 260..327 CDD:214653 18/76 (24%)
I-set 341..428 CDD:254352 27/93 (29%)
IGc2 356..419 CDD:197706 21/69 (30%)
FN3 435..524 CDD:238020 20/96 (21%)
FN3 554..636 CDD:238020 18/93 (19%)
NCAM2XP_011527877.1 Ig1_NCAM-2 46..137 CDD:143274
I-set 47..136 CDD:254352
I-set 142..218 CDD:254352 18/87 (21%)
IGc2 153..214 CDD:197706 16/80 (20%)
Ig 233..326 CDD:299845 25/96 (26%)
I-set 240..323 CDD:254352 23/86 (27%)
Ig5_NCAM-2 325..422 CDD:143278 21/102 (21%)
IG_like 333..420 CDD:214653 20/92 (22%)
IG_like 438..515 CDD:214653 23/80 (29%)
IGc2 439..507 CDD:197706 21/71 (30%)
FN3 521..613 CDD:238020 20/96 (21%)
fn3 619..703 CDD:278470 20/120 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.