DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and NCAM1

DIOPT Version :10

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001387553.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:1129 Species:Homo sapiens


Alignment Length:635 Identity:148/635 - (23%)
Similarity:239/635 - (37%) Gaps:136/635 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 VNLTAIRESDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGGSLIRIPP--------VNQTIREGQ 166
            :.:..|:::|:|.|.|:       ..:...|......:|  .::.:||        ||.|...||
Human   174 LQIRGIKKTDEGTYRCE-------GRILARGEINFKDIQ--VIVNVPPTIQARQNIVNATANLGQ 229

  Fly   167 TAFFHCVMKHPENSQASWYKDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMSDLGEYECKVRNSDG 231
            :....|..:.......||.|||..:::.:|..:..:......|:|.....:|..||.|...|..|
Human   230 SVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAG 294

  Fly   232 ELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPLKNLRW---------------- 280
            | |.|...|.:..|.|:.|...:..:...:...|.|. .:..|:.::.|                
Human   295 E-QDATIHLKVFAKPKITYVENQTAMELEEQVTLTCE-ASGDPIPSITWRTSTRNISSEEKASWT 357

  Fly   281 --EKDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIF 343
              ||...| |.:.|.....::: ||....:....||.|.||..|.:|.|..|..:.| ...|.:.
Human   358 RPEKQETL-DGHMVVRSHARVS-SLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEV-QYAPKLQ 419

  Fly   344 SVTPKAIYIQKLGEAAELPCEAIDRDGNNRPS--IIWGRKDGQPLPADRFS-------LSGGNLT 399
            .  |.|:|..: |....:.||..     ..||  |.|.| |||.||:..:|       .|...|.
Human   420 G--PVAVYTWE-GNQVNITCEVF-----AYPSATISWFR-DGQLLPSSNYSNIKIYNTPSASYLE 475

  Fly   400 ITGLVEGDRGIYECSATNEAATITAEAELMIENIAPRA-------PYNLTA----NSTETCITIR 453
            :|...|.|.|.|.|:|.|.....:.|. ::::...|.:       ||:.||    :..|....: 
Human   476 VTPDSENDFGNYNCTAVNRIGQESLEF-ILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGV- 538

  Fly   454 WQPGYLRPNLEYTVWYRLMEAPEWRTLRVLDKK--VME--ATVQHLQPGKEYEFMVLSQDKYGDG 514
                   |.|:|...:|.:....|.: :..|.|  .||  .|:..|:|...|...:.:.:..|.|
Human   539 -------PILKYKAEWRAVGEEVWHS-KWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLG 595

  Fly   515 MFSKQFRFQTLPSPIRADDFDAQQLQHDLGQVTAPAGGLGAPWNLTAISNQQGWLLHWEHPVQGL 579
            ..|....|:|  .|:|  :..|.:|:..:|:     .|.....||  |....|.           
Human   596 EISAASEFKT--QPVR--EPSAPKLEGQMGE-----DGNSIKVNL--IKQDDGG----------- 638

  Fly   580 EGLRLYAVRW------WKEPEHFLIGHAETFDNYYQLRHLKEDTLFKVQVLAVGTETQQ--SVPS 636
            ..:|.|.||:      || ||..|    .:..::..|:.|..:..::|.|:|   |.||  |..:
Human   639 SPIRHYLVRYRALSSEWK-PEIRL----PSGSDHVMLKSLDWNAEYEVYVVA---ENQQGKSKAA 695

  Fly   637 HELL------IDVPSQ-RKVRALIIGSSVGVIFLLCAL--------CAFL 671
            |.:.      ..:|:. .....|..|:.||::.::..|        |.||
Human   696 HFVFRTSAQPTAIPANGSPTSGLSTGAIVGILIVIFVLLLVVVDITCYFL 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 5/17 (29%)
Ig strand C 69..72 CDD:409512
Ig strand E 108..112 CDD:409512 0/1 (0%)
Ig strand F 122..127 CDD:409512 2/4 (50%)
Ig 153..242 CDD:472250 26/96 (27%)
Ig strand B 168..172 CDD:409544 0/3 (0%)
Ig strand C 181..185 CDD:409544 1/3 (33%)
Ig strand E 207..211 CDD:409544 1/3 (33%)
Ig strand F 221..226 CDD:409544 3/4 (75%)
Ig strand G 235..238 CDD:409544 1/2 (50%)
Ig_3 247..322 CDD:464046 18/92 (20%)
Ig 341..428 CDD:472250 28/95 (29%)
Ig strand B 359..363 CDD:409353 0/3 (0%)
Ig strand C 375..380 CDD:409353 3/6 (50%)
Ig strand E 396..400 CDD:409353 1/3 (33%)
Ig strand F 410..415 CDD:409353 2/4 (50%)
Ig strand G 423..426 CDD:409353 0/2 (0%)
FN3 435..524 CDD:238020 23/103 (22%)
FN3 554..636 CDD:238020 22/89 (25%)
NCAM1NP_001387553.1 IgI_1_NCAM-1 20..116 CDD:409451
Ig strand A 20..25 CDD:409451
Ig strand A' 28..32 CDD:409451
Ig strand B 34..44 CDD:409451
Ig strand C 50..56 CDD:409451
Ig strand C' 59..61 CDD:409451
Ig strand D 69..75 CDD:409451
Ig strand E 77..85 CDD:409451
Ig strand F 92..100 CDD:409451
Ig strand G 104..115 CDD:409451
IG_like 124..190 CDD:214653 4/15 (27%)
Ig strand B 135..139 CDD:409353
Ig strand C 148..152 CDD:409353
Ig strand E 172..176 CDD:409353 0/1 (0%)
Ig 211..307 CDD:472250 26/96 (27%)
Ig strand B 231..235 CDD:409353 0/3 (0%)
Ig strand C 244..248 CDD:409353 1/3 (33%)
Ig strand E 270..274 CDD:409353 1/3 (33%)
Ig strand F 284..289 CDD:409353 3/4 (75%)
Ig strand G 297..300 CDD:409353 1/2 (50%)
IgI_NCAM-1 306..412 CDD:143277 23/108 (21%)
Ig strand A 306..311 CDD:143277 2/4 (50%)
Ig strand A' 315..319 CDD:143277 0/3 (0%)
Ig strand B 324..332 CDD:143277 2/8 (25%)
Ig strand C 338..344 CDD:143277 1/5 (20%)
Ig strand C' 347..350 CDD:143277 0/2 (0%)
Ig strand D 368..374 CDD:143277 1/5 (20%)
Ig strand E 377..383 CDD:143277 2/6 (33%)
Ig strand F 391..399 CDD:143277 4/7 (57%)
Ig strand G 402..412 CDD:143277 3/9 (33%)
IG_like 421..499 CDD:214653 27/84 (32%)
Ig strand B 432..436 CDD:409353 0/3 (0%)
Ig strand C 445..449 CDD:409353 1/3 (33%)
Ig strand E 472..476 CDD:409353 1/3 (33%)
Ig strand F 486..491 CDD:409353 2/4 (50%)
fn3 511..598 CDD:394996 20/95 (21%)
fn3 612..693 CDD:394996 25/106 (24%)
PRK12323 <913..1108 CDD:481241
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.