DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and dpr17

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:289 Identity:60/289 - (20%)
Similarity:98/289 - (33%) Gaps:72/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NLEAKVGSHVVFNCYIDFPFDAPIPYLVHWT--KDNKKIFTWYEQETSTSELFNGRLHLVENHPE 104
            |:.|::|:|....|.|....|.|    |.|.  :||..|     ....|:.:.:.|...:.....
  Fly   414 NITAQMGNHAYMPCQIHRLSDKP----VSWVRMRDNHII-----SVDETTFIADERFQSIYQEDH 469

  Fly   105 FGRASVNLTAIRESDQGWYHCQVSF-PNRSPSVRNNGTAYHLAVQGGSLIRIPPVNQTIREGQTA 168
            ....|:.:..:..||.|||.||::. |..|..|       ||.:.......|...::.::.|...
  Fly   470 DYTWSLQIKYVEPSDAGWYECQMATEPKLSAKV-------HLQIVKPKTELIGDQSRFVKAGSKV 527

  Fly   169 FFHCVMK------------------HPENSQASWYKDGVLLQEVQDLVRRFY--MGPD----GSL 209
            ..||:::                  ...:.:..||         ..|.|..:  :|.:    |||
  Fly   528 ALHCIVRGTLDPPKYIIWFRGQKKISDSDERTGWY---------TQLDRNIFGTVGDNQNTIGSL 583

  Fly   210 SIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPP 274
            .|......|.|.|.|:..|| ..:......|:.:|.|..|.:........|:..   ||...   
  Fly   584 IIPLVRKEDSGNYTCQPSNS-VSVSVDLHVLSGEYSASAIMSTAARTTKGGRST---CHSTL--- 641

  Fly   275 LKNLRWEKDGLLFDSYNVPGVFYKMNGSL 303
                     |||    .:.|:.:.|.|::
  Fly   642 ---------GLL----GILGLLWAMQGAM 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 23/87 (26%)
Ig 43..131 CDD:299845 22/90 (24%)
I-set 153..242 CDD:254352 20/112 (18%)
Ig 157..242 CDD:299845 19/108 (18%)
Ig_2 252..337 CDD:290606 9/52 (17%)
IG_like 260..327 CDD:214653 9/44 (20%)
I-set 341..428 CDD:254352
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 21/85 (25%)
Ig 415..507 CDD:299845 27/107 (25%)
IG_like 521..612 CDD:214653 18/100 (18%)
IGc2 524..605 CDD:197706 18/90 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.