DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and Ama

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:340 Identity:86/340 - (25%)
Similarity:132/340 - (38%) Gaps:64/340 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 GTAYHLAVQGGSLIRIPPVNQTIRE-----GQTAFFHCVMKHPENSQASWYK-------DGVLLQ 192
            |..:.||:...|::..|.::|..::     |.:..|:|.::.......||.|       :.|:|.
  Fly    17 GLIFCLAISLDSVLSAPVISQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLS 81

  Fly   193 EVQDLVRRFYMGPDGSLSIDPT-----------------MMSDLGEYECKVRNSDGELQTAKAFL 240
                 :|.....||...::..|                 .:||:|.|||:|..|..|..|.|  |
  Fly    82 -----MRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKK--L 139

  Fly   241 NIQYKAKVIYA---PPEVFLPYGQPAVLDCHFRANP-PLKNLRWEKDGLLFDSYNVPGVFYKMNG 301
            ::|.|...:.|   |....:..||...|.||  ||. |...:.|.::   .::....|.......
  Fly   140 SLQIKTPPVIAENTPKSTLVTEGQNLELTCH--ANGFPKPTISWARE---HNAVMPAGGHLLAEP 199

  Fly   302 SLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIFSVTPKAIYIQKLGEAAELPCEAI 366
            :|....|.....|.|.|...|..|......:...:..||.|....||  ..|.:..:|||.|.. 
  Fly   200 TLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPK--IAQMVSHSAELECSV- 261

  Fly   367 DRDGNNRPSIIWGRKDGQPLPADRF-------SLSGGN---LTITGLVEGDRGIYECSATNEAAT 421
              .|...|:::| .|:|.||.:.|.       |.||..   |.|..:.|.|.|.|.|:|||:.. 
  Fly   262 --QGYPAPTVVW-HKNGVPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYYCNATNKLG- 322

  Fly   422 ITAEAEL-MIENIAP 435
             .|:|.| :.:.:.|
  Fly   323 -HADARLHLFQTVIP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 26/117 (22%)
Ig 157..242 CDD:299845 25/113 (22%)
Ig_2 252..337 CDD:290606 18/85 (21%)
IG_like 260..327 CDD:214653 17/67 (25%)
I-set 341..428 CDD:254352 31/96 (32%)
IGc2 356..419 CDD:197706 25/72 (35%)
FN3 435..524 CDD:238020 1/1 (100%)
FN3 554..636 CDD:238020
AmaNP_731114.2 I-set 33..143 CDD:254352 26/116 (22%)
Ig 37..127 CDD:299845 19/94 (20%)
IG_like 154..234 CDD:214653 18/84 (21%)
IGc2 161..223 CDD:197706 16/66 (24%)
I-set 254..330 CDD:254352 28/81 (35%)
IGc2 254..322 CDD:197706 25/71 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.