DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and Cont

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_649461.2 Gene:Cont / 40553 FlyBaseID:FBgn0037240 Length:1390 Species:Drosophila melanogaster


Alignment Length:745 Identity:166/745 - (22%)
Similarity:271/745 - (36%) Gaps:195/745 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QSGSALLALLAIILLMNISCT--SAARDHRR-----------QTNLEAKV--------------- 47
            :.|:...:.:..:...|.|||  :...|..|           .:|.:|.:               
  Fly   521 RDGALYFSFIETVDRANYSCTVQTLVSDTGRNGPFFPLRVTPNSNYQALIFANTFPKVFPEAPVA 585

  Fly    48 GSHVVFNCYIDFPFDAPIPYLVHWTKDNKKIFTWYEQETSTSELFNGRLHLVENHPEFGRASVNL 112
            |..:...|   ..|..||| ..:||:....:      :.:...:..||:.:::|      |:.| 
  Fly   586 GDEIRLEC---MAFGYPIP-SYNWTRQGLPL------QRNAYTINYGRVLIIQN------ATTN- 633

  Fly   113 TAIRESDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGGSLIRIPPVNQTIREGQTAFFHCVMKHP 177
                  |.|.|.|.::.|.::..     .:.::.:|......||..:..........|.|.....
  Fly   634 ------DNGEYSCTITNPRKTLM-----KSIYINIQMRPQFTIPLKDMIKDYNSDVTFICEAFAI 687

  Fly   178 ENSQASWYKDGVLLQEVQDLVRRFYMGPDGSLSI-------DPTMMSDLGEYECKVRNSDGELQT 235
            .::..:|||:...| :..::.|..|:..|..|:|       |..|      |:|..:|   :|:|
  Fly   688 PDANYTWYKNAERL-DPANINRDRYIIQDNVLTIKFLEKDKDDAM------YQCGAQN---QLKT 742

  Fly   236 AKAFLNIQYKAKVIYAPP---------EVFLPYGQPAVLDCHFRANPPLKNLRWEKDGLLFDSYN 291
              :|.:.|  .:|:...|         ||:..|.....:.|...|.|..| .:|:|||.:..|  
  Fly   743 --SFSSAQ--LRVLSMKPSFKKHPLESEVYAVYNGNTTIVCDPEAAPRPK-FQWKKDGQVIGS-- 800

  Fly   292 VPGVFYKM--NGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIFSVTPKAIYIQK 354
              |...::  :|:|..:....:..|.|||...|..|||  .....||||:...|..||....:.|
  Fly   801 --GGHRRILPSGTLTISPTSRDDEGIYTCIASNQAGTD--ESHARVIVLQEIRFIETPPQRIVSK 861

  Fly   355 LGEAAELPCEAI--------------------DRDGNNRPSIIWGRKDGQPLPADRFSLSGGNLT 399
            ..:...|.|||.                    :.||..|..:.|.|                 ||
  Fly   862 EHDLIFLHCEAAFDELLDIAYVWKHNGEVLKNNHDGTGRIIVDWNR-----------------LT 909

  Fly   400 ITGLVEGDRGIYEC---SATNEAATITAEAELMIENIAPRAPYNL-TANSTETCITIRWQPGYLR 460
            :......|.|.|||   ||.||   |:::..:.||. ||.||..: ....::|...|.|..|  .
  Fly   910 VHNTSMRDAGDYECVVKSAVNE---ISSKTSVSIEG-APGAPGGVQVIQISKTKAIIEWVDG--S 968

  Fly   461 PNLEYTVWYRLMEAPEW-RT---------LRVLDKKV--MEATVQHLQPGKEYEFMVLSQDKYGD 513
            .|.....:|.::....| ||         .|.:|:..  .:|.|.:|.|...|||.|.:.:..|.
  Fly   969 HNGRAIRYYNILGRTNWNRTWVNVSTHVQAREVDRYTSRQQAEVVNLTPWSAYEFSVTAVNDLGI 1033

  Fly   514 GMFSKQFRFQTLPSPIRADDFDAQQL-QHDLGQVTAPAGGLGAPWNLTAISNQQGWLLH----WE 573
            |.       .:.||||.:...|...: ..::|......|.|...|:......|....:|    |:
  Fly  1034 GT-------PSAPSPIYSTYEDKPYIAPRNVGGGGGKIGDLTITWDPLLPQEQHSHGIHYKVFWK 1091

  Fly   574 HPVQGLEGLRLYAVRW----WKEPEHFLIGHAE-TFDNYYQLRHLKEDTLFKVQVLAV-----GT 628
                 |:|    |:.|    .|:.:|..:.... ..:|||        |.::|:|.|:     |.
  Fly  1092 -----LKG----AIEWASDEIKKQDHMGVAVVNIPLNNYY--------TEYEVKVQAINSVGKGP 1139

  Fly   629 ETQQSV-PSHELLIDVPSQRKVRALIIGSS 657
            |::.:| .|.|.:..|..|:.: ||...|:
  Fly  1140 ESEIAVIHSAEDMPQVAPQKPI-ALAYNST 1168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 19/100 (19%)
Ig 43..131 CDD:299845 18/102 (18%)
I-set 153..242 CDD:254352 21/95 (22%)
Ig 157..242 CDD:299845 19/91 (21%)
Ig_2 252..337 CDD:290606 25/95 (26%)
IG_like 260..327 CDD:214653 18/68 (26%)
I-set 341..428 CDD:254352 25/109 (23%)
IGc2 356..419 CDD:197706 19/85 (22%)
FN3 435..524 CDD:238020 24/101 (24%)
FN3 554..636 CDD:238020 20/96 (21%)
ContNP_649461.2 CLECT 139..>223 CDD:214480
Ig 361..460 CDD:299845
I-set 362..462 CDD:254352
Ig 466..559 CDD:299845 7/37 (19%)
IG_like 584..657 CDD:214653 18/100 (18%)
IGc2 586..645 CDD:197706 17/81 (21%)
Ig 667..751 CDD:299845 20/97 (21%)
IG_like 676..751 CDD:214653 20/88 (23%)
IG_like 765..844 CDD:214653 24/85 (28%)
Ig 773..844 CDD:299845 21/77 (27%)
I-set 851..940 CDD:254352 24/108 (22%)
Ig 866..944 CDD:299845 23/98 (23%)
FN3 944..1043 CDD:238020 27/107 (25%)
FN3 1053..1146 CDD:238020 22/109 (20%)
fn3 1156..1244 CDD:278470 4/14 (29%)
fn3 1259..1346 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10075
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.