DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and LSAMP

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:322 Identity:76/322 - (23%)
Similarity:133/322 - (41%) Gaps:46/322 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 NQTIREGQTAFFHCVMKHPENSQASWY-KDGVL--------LQEVQDLVRRFYMGPDGSLSIDPT 214
            |.|:|:|.||...||:: .:||:.:|. :.|::        |....:|.:|..:  :.||.|...
Human    40 NITVRQGDTAILRCVVE-DKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSL--EYSLRIQKV 101

  Fly   215 MMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANP-PLKNL 278
            .:.|.|.|.|.|: :..|.:|::.:|.:|...|:.....:|.:..|....|.|.....| |:  :
Human   102 DVYDEGSYTCSVQ-TQHEPKTSQVYLIV
QVPPKISNISSDVTVNEGSNVTLVCMANGRPEPV--I 163

  Fly   279 RWE---KDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRP 340
            .|.   ..|..|:...   .:.::.|      :....:|.|.|...|::.:.....| .|.|..|
Human   164 TWRHLTPTGREFEGEE---EYLEILG------ITREQSGKYECKAANEVSSADVKQV-KVTVNYP 218

  Fly   341 PIFSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQPLPADRFSLSG----GNLTIT 401
            |  ::|.........|..|.|.|||   .....|...|.|.|.:...|:...:..    .:||:|
Human   219 P--TITESKSNEATTGRQASLKCEA---SAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVT 278

  Fly   402 GLVEGDRGIYECSATNEAATITAEAELMIENIAPRAPYNLTANSTETCITIRWQ---PGYLR 460
            .:.|...|.|.|.|.|:.. :|..:.::.:.:.|..|:.:....|    |:.::   ||.:|
Human   279 NVTEEHYGNYTCVAANKLG-VTNASLVLFKRVLPTIPHPIQEIGT----TVHFKQKGPGSVR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 26/91 (29%)
Ig 157..242 CDD:299845 26/91 (29%)
Ig_2 252..337 CDD:290606 16/88 (18%)
IG_like 260..327 CDD:214653 13/70 (19%)
I-set 341..428 CDD:254352 23/90 (26%)
IGc2 356..419 CDD:197706 20/66 (30%)
FN3 435..524 CDD:238020 7/29 (24%)
FN3 554..636 CDD:238020
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 26/91 (29%)
Ig 132..215 CDD:386229 17/94 (18%)
Ig_3 219..294 CDD:372822 21/79 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.