DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and dpr10

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:304 Identity:63/304 - (20%)
Similarity:94/304 - (30%) Gaps:101/304 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 PVNQTIREGQTAFFHCVMKHPENSQASW--YKDGVLL----------QEVQDLVRRFYMGPDGSL 209
            |.|.|...|::|:..|.:||..|...:|  ::|..:|          |..|....|..  .:.:|
  Fly    60 PRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDI--DEWTL 122

  Fly   210 SIDPTMMSDLGEYECKVR-----------------------------NSD--------------- 230
            .|......|.|.|||::.                             |.|               
  Fly   123 QIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSND 187

  Fly   231 ------GELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDC--HFRANPPLKNLRWEKDGLLF 287
                  |.:||      :......|...|::::..|....|.|  .|...||.....:.:|.:|.
  Fly   188 EFAGMFGPIQT------VAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLS 246

  Fly   288 DSYNVPGVFYKMNGS------LFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIFSVT 346
            :..:...:.:|...|      |.....|..|:|.|:|.|.|   |:..|  |.|.||:    ...
  Fly   247 EETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSN---TEIAS--IRVHVLQ----GER 302

  Fly   347 PKAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQPLPADR 390
            |:|:.......|..|.|              |....||...|.|
  Fly   303 PEAMQTNAAPAAVALAC--------------WSCHFGQATQAVR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 27/146 (18%)
Ig 157..242 CDD:299845 27/146 (18%)
Ig_2 252..337 CDD:290606 23/92 (25%)
IG_like 260..327 CDD:214653 18/74 (24%)
I-set 341..428 CDD:254352 10/50 (20%)
IGc2 356..419 CDD:197706 8/35 (23%)
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
dpr10NP_729591.1 Ig 63..143 CDD:299845 20/81 (25%)
IG_like 210..297 CDD:214653 23/91 (25%)
IGc2 217..287 CDD:197706 17/69 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.