DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and L1CAM

DIOPT Version :10

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_000416.1 Gene:L1CAM / 3897 HGNCID:6470 Length:1257 Species:Homo sapiens


Alignment Length:611 Identity:143/611 - (23%)
Similarity:235/611 - (38%) Gaps:154/611 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 ENHPEFGRASVNLTAIRESDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGGSLIRIPPVNQTIRE 164
            :||    ..::.|..:.|.|.|.|.|...  |...|.|:   ||::.|:........|.:.....
Human   291 QNH----NKTLQLLKVGEEDDGEYRCLAE--NSLGSARH---AYYVTVEAAPYWLHKPQSHLYGP 346

  Fly   165 GQTAFFHCVMKHPENSQASWYKDGVLLQEV-QDLVRRFYMGPDGSLSIDPTMMSDLGEYECKVRN 228
            |:||...|.::.....:.:|..:|:.::|: :|   :.|....|:|.:.....||....:|:.||
Human   347 GETARLDCQVQGRPQPEVTWRINGIPVEELAKD---QKYRIQRGALILSNVQPSDTMVTQCEARN 408

  Fly   229 SDGELQTAKAFLN-IQYKAKVIYAPPEVFLP-YGQPAVLDCH-FRANPPLKNLRW-EKDG--LLF 287
            ..| |..|.|::. :|..||::.|..:.::. .|..|.|.|. |.|  |:.:::| ::||  :|.
Human   409 RHG-LLLANAYIYVVQLPAKILTADNQTYMAVQGSTAYLLCKAFGA--PVPSVQWLDEDGTTVLQ 470

  Fly   288 DSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLG----------------TDGPSPVISVI 336
            |....|    ..||:|....:..|..|.|.|...||..                |.||...    
Human   471 DERFFP----YANGTLGIRDLQANDTGRYFCLAANDQNNVTIMANLKVKDATQITQGPRST---- 527

  Fly   337 VLRPPIFSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQPL----PADRFSLSGGN 397
                           |:|.|......|:| ..|.:.:|||.| |.||:.|    .:|::.:..|.
Human   528 ---------------IEKKGSRVTFTCQA-SFDPSLQPSITW-RGDGRDLQELGDSDKYFIEDGR 575

  Fly   398 LTITGLVEGDRGIYECSATNEAATITAEAELMI---ENIAPRAPYNLTANSTETCITIRWQPG-- 457
            |.|..|...|:|.|.|.|:.|...:.:.|:|::   ....||...:.....|::.:.:.|.|.  
Human   576 LVIHSLDYSDQGNYSCVASTELDVVESRAQLLVVGSPGPVPRLVLSDLHLLTQSQVRVSWSPAED 640

  Fly   458 YLRPNLEYTV-----------WYRLMEAPEWRTLRVLDKKVMEATVQHLQPGKEYEFMVLSQDKY 511
            :..|..:|.:           ||.|.:.|..:|          :|...|.|...|.|.|.:.:||
Human   641 HNAPIEKYDIEFEDKEMAPEKWYSLGKVPGNQT----------STTLKLSPYVHYTFRVTAINKY 695

  Fly   512 GDGMFSKQFRFQTLPSPIRADDFDAQQLQHDLGQVTAPAGGLGAPWNLTAISNQQGWLLHWEHP- 575
            |.|..|..  .:|:.:|..|.:.:...::.:..:.|          |:........| :.|..| 
Human   696 GPGEPSPV--SETVVTPEAAPEKNPVDVKGEGNETT----------NMVITWKPLRW-MDWNAPQ 747

  Fly   576 VQGLEGLRLYAVRW--------WKE---PEHFL-IGHAETFDNYYQLRHLKEDTLFKVQVLAV-- 626
            ||       |.|:|        |:|   .:.|| :.:..||..|            :::|.||  
Human   748 VQ-------YRVQWRPQGTRGPWQEQIVSDPFLVVSNTSTFVPY------------EIKVQAVNS 793

  Fly   627 ---GTETQ-----------QSVPSHE 638
               |.|.|           |::|..|
Human   794 QGKGPEPQVTIGYSGEDYPQAIPELE 819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 8/27 (30%)
Ig strand C 69..72 CDD:409512
Ig strand E 108..112 CDD:409512 0/3 (0%)
Ig strand F 122..127 CDD:409512 2/4 (50%)
Ig 153..242 CDD:472250 21/90 (23%)
Ig strand B 168..172 CDD:409544 1/3 (33%)
Ig strand C 181..185 CDD:409544 0/3 (0%)
Ig strand E 207..211 CDD:409544 2/3 (67%)
Ig strand F 221..226 CDD:409544 1/4 (25%)
Ig strand G 235..238 CDD:409544 1/2 (50%)
Ig_3 247..322 CDD:464046 22/79 (28%)
Ig 341..428 CDD:472250 26/90 (29%)
Ig strand B 359..363 CDD:409353 0/3 (0%)
Ig strand C 375..380 CDD:409353 3/4 (75%)
Ig strand E 396..400 CDD:409353 2/3 (67%)
Ig strand F 410..415 CDD:409353 2/4 (50%)
Ig strand G 423..426 CDD:409353 0/2 (0%)
FN3 435..524 CDD:238020 23/101 (23%)
FN3 554..636 CDD:238020 23/110 (21%)
L1CAMNP_000416.1 Ig 35..130 CDD:472250
Ig strand B 53..57 CDD:409353
Ig strand C 66..70 CDD:409353
Ig strand E 93..97 CDD:409353
Ig strand F 111..116 CDD:409353
Ig strand G 125..128 CDD:409353
IgI_2_L1-CAM_like 140..230 CDD:409432
Ig strand A 140..143 CDD:409432
Ig strand A' 145..149 CDD:409432
Ig strand B 152..160 CDD:409432
Ig strand C 167..173 CDD:409432
Ig strand C' 176..179 CDD:409432
Ig strand D 185..189 CDD:409432
Ig strand E 191..195 CDD:409432
Ig strand F 206..214 CDD:409432
Ig strand G 217..230 CDD:409432
Ig3_L1-CAM 248..330 CDD:409460 13/47 (28%)
Ig strand B 260..264 CDD:409460
Ig strand C 273..277 CDD:409460
Ig strand E 295..299 CDD:409460 0/3 (0%)
Ig strand F 309..314 CDD:409460 2/4 (50%)
Ig strand G 322..325 CDD:409460 1/5 (20%)
Ig4_L1-CAM_like 334..422 CDD:409453 21/91 (23%)
Ig strand B 350..354 CDD:409453 1/3 (33%)
Ig strand C 363..367 CDD:409453 0/3 (0%)
Ig strand E 387..391 CDD:409453 2/3 (67%)
Ig strand F 401..406 CDD:409453 1/4 (25%)
Ig strand G 414..417 CDD:409453 1/2 (50%)
Ig 428..514 CDD:472250 23/91 (25%)
Ig strand B 444..448 CDD:409353 2/3 (67%)
Ig strand C 457..461 CDD:409353 0/3 (0%)
Ig strand E 480..484 CDD:409353 2/3 (67%)
Ig strand F 494..499 CDD:409353 2/4 (50%)
Ig strand G 507..510 CDD:409353 0/2 (0%)
Ig_3 519..594 CDD:464046 26/95 (27%)
Cell attachment site. /evidence=ECO:0000255 554..556 1/1 (100%)
FN3 612..709 CDD:238020 24/108 (22%)
FN3 <627..>837 CDD:442628 50/235 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 698..725 5/28 (18%)
fn3 824..907 CDD:394996
FN3 918..1003 CDD:238020
Bravo_FIGEY 1144..1233 CDD:464016
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1176..1207
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1226..1257
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.