DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and Dscam2

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster


Alignment Length:656 Identity:144/656 - (21%)
Similarity:224/656 - (34%) Gaps:206/656 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 PIPYLVHWTKDNKKIFTWYEQETSTSELFNGRLHLVENHPEFGR--ASVNLTAIRESDQGWYHCQ 126
            |.|. :.||.|...:.:            |||..:.:.....|.  :.||::.:...|.|.|.|.
  Fly   450 PTPQ-ISWTLDGFPLPS------------NGRFMIGQYITVHGDVISHVNISHVMVEDGGEYACI 501

  Fly   127 VSFPNRSPSVRNNGTAYHLAVQGGSLIRIPPVNQTIREGQTAFFHCVMKHPENSQASWYKDGVLL 191
            ..  ||:..|::   |..|.:.|...||:.| ..|...|:|....|.:......:..|.:.|   
  Fly   502 AE--NRAGRVQH---AARLNI
YGLPYIRLIP-KVTAVSGETLNLKCPVAGYPIEEIHWERGG--- 557

  Fly   192 QEVQDLVRRFYMGPDGSLSIDPTMM-SDLGEYECKVRNSDGELQTAKAFLNIQYKAK-----VIY 250
            :|:.|.:|: .:.|||||:|.|... ||.|.|.|..||..|            :.|:     .:.
  Fly   558 RELPDDIRQ-RVQPDGSLTISPVQKNSDSGVYTCWARNKQG------------HSARRSGEVTVI 609

  Fly   251 APPEVF--------LPYGQPAVLDCH-FRANPPLKNLRWEKDG-----------LLFDSYN---- 291
            .||::.        |..|..|.|.|. .:.:.|| .:.|.|||           ...|.||    
  Fly   610 VPPKLSPFQTNILQLNMGDRASLTCSVVKGDLPL-TINWRKDGRPIDPTQHMSVKQVDQYNSILV 673

  Fly   292 --------------------------------------------------------------VPG 294
                                                                          .|.
  Fly   674 IENLGSDHTGNYSCVVRNSAAEVENSQALLVNVPPRWIVEPVDANVERNRHIMLHCQAQGVPTPS 738

  Fly   295 VFYKM----------------------NGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIV 337
            :.:|.                      ||||....|.|:..|.|.|...|.:|| |...||.:.|
  Fly   739 IVWKKATGSKSGEYEEVRERPFTKLLGNGSLLLQHVKEDREGFYLCQANNGIGT-GIGKVIQLKV 802

  Fly   338 LRPPIFSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQPL-PADRFSLS------- 394
            ...|.||.|.:::.::| |:.|.|.|..   .|:...:|:|.|.....| |:..:.:|       
  Fly   803 NSSPYFSSTSRSVMVKK-GDTALLQCAV---SGDKPINIVWMRSGKNTLNPSTNYKISVKQEATP 863

  Fly   395 ---GGNLTITGLVEGDRGIYECSATNEAATITAEAELMIENIAPRAPYNL-TANSTETCITIRWQ 455
               ...|.|..:...|.|.|.|.|:|.........:|.::. .|..|..| .|..:...:.|:||
  Fly   864 DGVSAELQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQE-PPLPPSVLEAAMISSRSVNIKWQ 927

  Fly   456 PGYLRPN--LEYTVWYR--------LMEAPEWRTLRVLDKKVMEATVQHLQPGKEYEFMVLSQDK 510
            |..|...  .:|.|.:|        .:...:|:.:.|.|.....|.:::|:|...|.|.|:::..
  Fly   928 PKTLGTGDVTKYIVEFREADHSLPPALFVDQWQQIEVKDPPHFNAMIENLKPATRYAFRVIAEGS 992

  Fly   511 YGDGMFSKQFRFQTLPSPIRADDFDAQQLQHDLGQVTAPAGGLGAPWNLTA--ISNQQGWLLHWE 573
            .|....|::...:|.|.                    .||   |.|.:|:|  :|:.: .|:.|.
  Fly   993 AGRSAPSQELIVRTEPQ--------------------RPA---GPPLSLSARPLSSTE-LLISWV 1033

  Fly   574 HPVQGL 579
            .|:..|
  Fly  1034 APLPEL 1039

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 15/65 (23%)
Ig 43..131 CDD:299845 15/68 (22%)
I-set 153..242 CDD:254352 27/89 (30%)
Ig 157..242 CDD:299845 25/85 (29%)
Ig_2 252..337 CDD:290606 33/192 (17%)
IG_like 260..327 CDD:214653 26/166 (16%)
I-set 341..428 CDD:254352 24/97 (25%)
IGc2 356..419 CDD:197706 19/73 (26%)
FN3 435..524 CDD:238020 23/99 (23%)
FN3 554..636 CDD:238020 9/28 (32%)
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653 20/84 (24%)
IGc2 436..507 CDD:197706 17/71 (24%)
I-set 521..610 CDD:254352 28/105 (27%)
IGc2 533..597 CDD:197706 22/67 (33%)
Ig 630..699 CDD:143165 12/69 (17%)
IG_like 714..802 CDD:214653 17/88 (19%)
Ig 725..802 CDD:299845 17/77 (22%)
Ig 823..894 CDD:143165 18/73 (25%)
FN3 906..1006 CDD:238020 23/99 (23%)
FN3 1013..1111 CDD:238020 9/28 (32%)
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10075
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.