DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and ImpL2

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:208 Identity:48/208 - (23%)
Similarity:72/208 - (34%) Gaps:62/208 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 FRANPPLK---------------------NLRW--------EKDGLLFDSYNV----PGVFYKMN 300
            |...||.|                     :::|        |.|.|  ||..|    |....::.
  Fly    60 FTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDL--DSNQVAEEAPSAIVRVR 122

  Fly   301 GSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIFS-----------VTPKAIYIQK 354
            .|.....| .:.|.:|||     :|..|...:.:..|:.||..|           ..|:.||.:|
  Fly   123 SSHIIDHV-LSEARTYTC-----VGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEK 181

  Fly   355 -----LGEAAELPCEAIDRDGNNRPSIIWGRKDGQPLPADRFS--LSGGNLTITGLVEGDRGIYE 412
                 :|...:|||....|.   |..|.|...:.:.:......  |:.|:|.|:.:...|.|.|:
  Fly   182 THLDLMGSNIQLPCRVHARP---RAEITWLNNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYK 243

  Fly   413 CSATNEAATITAE 425
            |.|.|.....||:
  Fly   244 CIARNVVGKDTAD 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352
Ig 157..242 CDD:299845
Ig_2 252..337 CDD:290606 20/100 (20%)
IG_like 260..327 CDD:214653 19/90 (21%)
I-set 341..428 CDD:254352 26/103 (25%)
IGc2 356..419 CDD:197706 18/64 (28%)
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 18/66 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.