DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and dpr20

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:211 Identity:46/211 - (21%)
Similarity:83/211 - (39%) Gaps:42/211 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TNLEAKVGSHVVFNCYIDFPFDAPIPYLVHWTKDNKKIFTWYEQETSTSELFNGRLH-------- 97
            |||..:.||.:..||.|....|..:.::.|.|:|..|      ...:..:|....:|        
  Fly   277 TNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGK------DNGNALDLLTVGMHTYTGDKRY 335

  Fly    98 -LVENHPEFGRASVNLTAIRESDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGGSLIRIPPVNQT 161
             :...:|...|  :.:|.:::.|:..|.||:|  ...|.|    ...:|.|....::.:..|...
  Fly   336 KMEFQYPNNWR--LKITNVKKDDEAIYECQIS--THPPRV----IQINLHVNAPKVMIVDEVGDP 392

  Fly   162 IRE-----GQTAFFHCVMKH--PENSQASW-YKDGVLLQEV--------QDLVRRFYMGPDGSLS 210
            ::|     ..|....||:::  ..:|...| :.|.:|..:|        .:|:..   |.:.:||
  Fly   393 LQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMED---GANSTLS 454

  Fly   211 IDPTMMSDLGEYECKV 226
            |.....:|.|.|.|.:
  Fly   455 IAKISKTDSGNYTCSI 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 21/94 (22%)
Ig 43..131 CDD:299845 21/96 (22%)
I-set 153..242 CDD:254352 19/90 (21%)
Ig 157..242 CDD:299845 19/86 (22%)
Ig_2 252..337 CDD:290606
IG_like 260..327 CDD:214653
I-set 341..428 CDD:254352
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
dpr20NP_612066.1 IG_like 278..365 CDD:214653 21/94 (22%)
Ig 279..378 CDD:299845 24/112 (21%)
Ig 400..471 CDD:299845 17/74 (23%)
IG_like 402..480 CDD:214653 17/72 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.