DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and CG13506

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:540 Identity:109/540 - (20%)
Similarity:174/540 - (32%) Gaps:192/540 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LEAKVGSHVVFNCYIDFPFDAPIPYLVHWTKDNKKIFTWYEQETSTSELFNG------RLHLVEN 101
            :|||.|..|:.||      ||.     ::...|..:  ||:....   :.||      |:..:.|
  Fly    79 VEAKPGDDVILNC------DAR-----NFQLSNAVV--WYKNRII---IANGQNPISQRVQCMLN 127

  Fly   102 HPEFGRASVNLTAIRESDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGGSLIR-------IPPVN 159
            :      |:.|..:...|...|:|:: .|.|   ||.     |.|::.|:.:.       |...:
  Fly   128 N------SILLRNVSPEDSDDYYCEI-LPQR---VRQ-----HTALRVGARLSILCDDRDITDRS 177

  Fly   160 QTIREGQTAFFHCVMKHPENSQASWYKDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMSDLGEYEC 224
            ||.|:|......|....|:|:...|                              ..:||.    
  Fly   178 QTFRQGDHHKLECRTYLPDNATIKW------------------------------SFNDLN---- 208

  Fly   225 KVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPLKNLRWEKDGLLFDS 289
                                               |||:.:|                       
  Fly   209 -----------------------------------GQPSSVD----------------------- 215

  Fly   290 YNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGTDG----PSPVISVIVLRPPIFSVTPKAI 350
                    ..||.:....|||.:||.|.|     |..||    |...:.:.|...||.|.....:
  Fly   216 --------NQNGVIILDNVDEKNAGDYQC-----LADDGSRHPPHGTVHIDVQYSPIVSTHRHNV 267

  Fly   351 YIQKLGEAAELPCEAIDRDGNNRPSIIWGR----KDGQPLP-ADRFSLSGG--------NLTITG 402
            ..:| |..|||.|       |.|...| ||    |||:.|. :|::||...        .|.:..
  Fly   268 NTEK-GATAELYC-------NYRAKPI-GRSYFIKDGKTLQLSDKYSLKDSVHNDHNRTTLIVRE 323

  Fly   403 LVEGDRGIYECSATNEAATITAEAELMIENIAPRAPY--NLTANSTETCITIRWQPGYLRPNLEY 465
            :.:.|.|.|.|...|...:...:..:   :..|..|.  ::|....:  :|:.|.....:...|.
  Fly   324 VTDSDLGEYLCQVENAIGSNEVKVHV---SYNPETPQFEDMTVEGNK--VTLHWLVRSHQLLSEA 383

  Fly   466 TVWYRLMEAPEWRTLRVLD-------KKVMEATVQ-HLQPGKEYEFMVLSQDKYGDGMFSKQFRF 522
            .:.|:|..:..|.|::||:       ..:.:.|.| .|..| .:...|.:::..|...||....|
  Fly   384 MLDYQLTGSYTWSTVQVLETHRHNNTDNIWKITHQLELSRG-VWHARVKTKNTKGWSHFSNDHVF 447

  Fly   523 QTLPSPIRADDFDAQQLQHD 542
            : :|.....|..:..:|..|
  Fly   448 E-IPEDSEVDKDEEVELPPD 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 21/90 (23%)
Ig 43..131 CDD:299845 21/93 (23%)
I-set 153..242 CDD:254352 11/95 (12%)
Ig 157..242 CDD:299845 10/84 (12%)
Ig_2 252..337 CDD:290606 17/88 (19%)
IG_like 260..327 CDD:214653 14/66 (21%)
I-set 341..428 CDD:254352 27/99 (27%)
IGc2 356..419 CDD:197706 23/75 (31%)
FN3 435..524 CDD:238020 21/98 (21%)
FN3 554..636 CDD:238020
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 20/88 (23%)
IGc2 83..146 CDD:197706 17/84 (20%)
IG_like 176..254 CDD:214653 27/182 (15%)
Ig 176..239 CDD:299845 24/167 (14%)
I-set 258..349 CDD:254352 27/99 (27%)
Ig 275..348 CDD:143165 22/80 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.