DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and dpr19

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:452 Identity:89/452 - (19%)
Similarity:155/452 - (34%) Gaps:136/452 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LALLAIILLM-----NISCTSAARDH-----------RRQTNLEAKVGSHVVFNCYIDFPFDAPI 65
            |.|...:||:     ::...:::::|           :..|.:.|:.|...:..|.:    ....
  Fly     8 LHLSCFLLLLSSTFSDVGKITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPCVV----KVNS 68

  Fly    66 PYLVHWTKDNKKIFTWYEQETSTSELFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHCQVS-F 129
            |..|.|.:  :|.|.......||..  :.:..|||:....|..|:.:.|:||.|:|:|.||:| :
  Fly    69 PATVSWIR--RKDFQLLTVGLSTHS--SDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIY 129

  Fly   130 PNRS--------PSVRNNGTAYHLAVQGGSLIRIPPVNQTIREGQTAFFHCVMKHPENSQA--SW 184
            |.:|        .:|....:|..|.:...|.:|:               .|.:|....:.|  .|
  Fly   130 PTQSIVIELKIVEAVAEISSAPELHIDETSTLRL---------------ECKLKRATENPAFVFW 179

  Fly   185 YKDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMSDLGE--------YECKVRNSDG---ELQTAKA 238
            |.|..::.         |....|      .:::.:|:        |.....|...   .::::..
  Fly   180 YHDSKMIN---------YDSQGG------FVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNG 229

  Fly   239 FLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPLKNLRWEKDGLLFDSYNVPGVFYKMNGS- 302
            .||....:......|...:|...|.:...|..|                         |.:|.| 
  Fly   230 VLNSLLGSSDAIKAPAANVPSSTPYMTQQHQSA-------------------------YLLNPSV 269

  Fly   303 --LFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIFSVTPKAIYIQKLGEAAELPCEA 365
              |...:|:..|||:|||.|.|               .||.  |:|...:..:|...........
  Fly   270 SVLTVKQVNFRHAGNYTCAPSN---------------ARPA--SITVHVLRGEKTAAMQHANRSI 317

  Fly   366 IDRDGNNRPS---IIWGRKDGQPLPADRFSLSGGNLTITGL------VEGDRGIYECSATNE 418
            :|.:.|...:   |..|..:|    ....:|:||.|..:||      |..||  :..:||::
  Fly   318 LDTETNGNGTFGLITLGGLNG----TSGVTLAGGILYFSGLFLLMGAVVFDR--FSLAATHK 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 23/85 (27%)
Ig 43..131 CDD:299845 24/88 (27%)
I-set 153..242 CDD:254352 13/101 (13%)
Ig 157..242 CDD:299845 12/97 (12%)
Ig_2 252..337 CDD:290606 18/87 (21%)
IG_like 260..327 CDD:214653 16/69 (23%)
I-set 341..428 CDD:254352 19/87 (22%)
IGc2 356..419 CDD:197706 16/72 (22%)
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 23/84 (27%)
IGc2 55..125 CDD:197706 20/77 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.