DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and fipi

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:349 Identity:83/349 - (23%)
Similarity:133/349 - (38%) Gaps:62/349 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 MSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPY--GQPAVLDCHFRANPPLKNL 278
            ::|.|.:.|:.  :||.|. :|:|..|.|: |:.:......:..  |:.|.:.|..:..|. .|:
  Fly    91 LADKGNWSCEA--ADGSLH-SKSFDLIV
YQ-KITFTENATVMTVKEGEKATILCEVKGEPQ-PNV 150

  Fly   279 RWE------KDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPY--NDLGTDGPSPVISV 335
            .|.      ..|...||     .|..:...|...||.:|..|.|.|..|  |.:.:|.....:.:
  Fly   151 TWHFNGQPISAGAADDS-----KFRILADGLLINKVTQNDTGEYACRAYQVNSIASDMQERTVLM 210

  Fly   336 IVLRPPIFSVTP----KAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQ--------PLPA 388
            .:...||:|.||    |..||   ...|.|.|||:.....|   ..|.||..:        .:.:
  Fly   211 KIEHKPIWSKTPFVSLKYAYI---NGTATLMCEALAEPPAN---FTWYRKHNKLHSNNRLYTIQS 269

  Fly   389 DRFSLSGGNLTITGLVEGDRGIYECSATNEAATITAEAELMIENIAPRAPYN-----LTANSTET 448
            |.:   ..:|||..|.......|.|.|.|:..||.....|. :...|.:|.|     ..:|:.:.
  Fly   270 DSY---WSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRLE-QGEKPPSPANFQLRGFNSNTFDV 330

  Fly   449 CITIRWQP--------GYLRPNLEY-TVWYRLMEAPEWRTLRVLDKKVMEAT---VQHLQPGKEY 501
            .::....|        |:   .:|| |......:|.:|...|..|....|..   :.:|:|...|
  Fly   331 VLSAPRGPPDSPMGVNGF---RIEYMTEMEFKTDAGKWTNARRKDYAFEEGATFLLTNLEPDTVY 392

  Fly   502 EFMVLSQDKYGDGMFSKQFRFQTL 525
            .....|::..|...|:|..:::||
  Fly   393 LVRAASRNLAGFSDFTKVEKYKTL 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 8/25 (32%)
Ig 157..242 CDD:299845 8/25 (32%)
Ig_2 252..337 CDD:290606 20/94 (21%)
IG_like 260..327 CDD:214653 19/74 (26%)
I-set 341..428 CDD:254352 28/98 (29%)
IGc2 356..419 CDD:197706 18/70 (26%)
FN3 435..524 CDD:238020 21/105 (20%)
FN3 554..636 CDD:238020
fipiNP_787975.1 IG_like 33..115 CDD:214653 8/26 (31%)
I-set 128..202 CDD:254352 19/79 (24%)
Ig 133..>193 CDD:299845 17/65 (26%)
IG_like 228..307 CDD:214653 22/87 (25%)
Ig 235..305 CDD:143165 20/75 (27%)
FN3 312..415 CDD:238020 21/105 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.