DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and CG33543

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:374 Identity:87/374 - (23%)
Similarity:144/374 - (38%) Gaps:59/374 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLALLAIILLMNISCTSAARDHRRQTNLEAKVGSHVVFNCYIDFPFDAPI------PYLVHWTKD 74
            |:||.:::||: :|..:|.......|:    .|.........|.|...|:      |.:.|:..:
  Fly     4 LIALCSLLLLL-LSQNAAILGQLDSTS----SGGSGTGGAPPDRPPTPPLSLQPSTPSITHFVNE 63

  Fly    75 NKKIF----------TWYEQETSTSELFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHCQVS- 128
            :..||          .|.:....|.|...||:|:.:.  ..|..::....|...|:|.:.|:|: 
  Fly    64 SFIIFCQTVQKDIDTKWRDPRGQTRENTKGRVHIEKK--TTGLLALVFEHIALEDRGNWTCEVNG 126

  Fly   129 --FPNRSPSVRNNGTA-YHLAV-QGGSLIRIPPVNQTIREGQTAFFHCVMKHPENSQASWYKDGV 189
              ..||:.:|.....| :.|.| |..|..:...| |::|||:.|..:|.::.....:.||..:|.
  Fly   127 NRNGNRNVNVEREFLASFELLVNQKISFGKTEQV-QSVREGRDAMVNCFVEGMPAPEVSWLYNGE 190

  Fly   190 LLQEVQDLV-RRFYMGPDGSLSIDPTMMSDLGEYECKVRN-----SDGELQTAKAFLNIQYKAKV 248
            .:..|.... .|...|    |.|.....:|.|||.|:...     ||.:..|  ..|.||:|...
  Fly   191 YINTVNSTKHNRLSNG----LYIRNVSQADAGEYTCRAMRITPTFSDSDQIT--ILLRIQHKPHW 249

  Fly   249 IY--APPEVFLPYGQPAVLDCHFRANPPLKNLRWEKDGLLFDSYNVPGVFYKM-----NGSLFFA 306
            .:  ..|..:...|....|.|.....|| .:..|     |.::..:.|..:::     ..:|...
  Fly   250 FFNETLPVQYAYVGGAVNLSCDAMGEPP-PSFTW-----LHNNKGIVGFNHRIFVADYGATLQLQ 308

  Fly   307 KVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIFSVTPKAIYIQKL 355
            ..:.:..|.|.|...|.||.     :..||.|||....:.|:...::||
  Fly   309 MKNASQFGDYKCKVANPLGM-----LERVIKLRPGPKPLGPRRFQLKKL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 19/101 (19%)
Ig 43..131 CDD:299845 20/106 (19%)
I-set 153..242 CDD:254352 24/94 (26%)
Ig 157..242 CDD:299845 24/90 (27%)
Ig_2 252..337 CDD:290606 17/89 (19%)
IG_like 260..327 CDD:214653 15/71 (21%)
I-set 341..428 CDD:254352 3/15 (20%)
IGc2 356..419 CDD:197706 87/374 (23%)
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 17/62 (27%)
IG_like 256..336 CDD:214653 18/90 (20%)
IGc2 263..327 CDD:197706 13/69 (19%)
FN3 341..445 CDD:238020 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.