DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and HSPG2

DIOPT Version :10

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_011539620.1 Gene:HSPG2 / 3339 HGNCID:5273 Length:4574 Species:Homo sapiens


Alignment Length:708 Identity:163/708 - (23%)
Similarity:258/708 - (36%) Gaps:222/708 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LEAKVGSHVV------FNCYIDFPFDAPIPYLVHWTKDNKKIFTWYEQ--------ETSTSELFN 93
            :||. .|||.      .||.:.....|.:              |||::        :|..|:|  
Human  3112 IEAS-SSHVTEGQTLDLNCVVPGQAHAQV--------------TWYKRGGSLPARHQTHGSQL-- 3159

  Fly    94 GRLHLVENHPEFGRASVNLTAIRESDQGWYHCQVSF---PNRSPSVR-----NNGTAYHLAVQGG 150
             |||||.                .:|.|.|.|:.:.   |.:..|..     :.|::|.|.   .
Human  3160 -RLHLVS----------------PADSGEYVCRAASGPGPEQEASFTVTVPPSEGSSYRLR---S 3204

  Fly   151 SLIRIPPVNQTIREGQTAFFHCVMKHPENSQAS--WYKDGVLLQEVQDLVRRFYMGPDGS-LSID 212
            .:|.|.|.:.|:::||.|.|.|:: |...:..|  |....   ||::|.|   ::.|:|| ::|.
Human  3205 PVISIDPPSSTVQQGQDASFKCLI-HDGAAPISLEWKTRN---QELEDNV---HISPNGSIITIV 3262

  Fly   213 PTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPP--------EVFLPYGQPAVLDCHF 269
            .|..|:.|.|.|...|:.|   .|::.:|:.     ::.||        .|::..|:...|:| .
Human  3263 GTRPSNHGTYRCVASNAYG---VAQSVVNLS-----VHGPPTVSVLPEGPVWVKVGKAVTLEC-V 3318

  Fly   270 RANPPLKNLRW-----------EKDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYND 323
            .|..|..:.||           ::...|.||:.|          |..:....:.||:|.|...|.
Human  3319 SAGEPRSSARWTRISSTPAKLEQRTYGLMDSHAV----------LQISSAKPSDAGTYVCLAQNA 3373

  Fly   324 LGTDGPSPVISVIVLRPPIFSVTPKAIYIQ--------KLGEAAELPCEAIDRDGNNRPSIIWGR 380
            |||  ....:.|||   ...::.|.|..:|        :.|..|.|.|.|   .|:..|:|.|. 
Human  3374 LGT--AQKQVEVIV---DTGAMAPGAPQVQAEEAELTVEAGHTATLRCSA---TGSPAPTIHWS- 3429

  Fly   381 KDGQPLPADRFSLSGGNLTITGLVEGDRGIYECSATNEAATITAEAELMIEN--IAPRAPYNLTA 443
            |...|||. :..|.|..|.|..:.:.|.|.|.|:||:.|....|...|.:|:  .|...|.:.:.
Human  3430 KLRSPLPW-QHRLEGDTLIIPRVAQQDSGQYICNATSPAGHAEATIILHVESPPYATTVPEHASV 3493

  Fly   444 NSTET----C-------ITIRWQ------PGYLRPNLEYTVWYRLMEAPEWRTLRVLDKKVMEAT 491
            .:.||    |       :|.:|.      ||......|...:.|  .|||               
Human  3494 QAGETVQLQCLAHGTPPLTFQWSRVGSSLPGRATARNELLHFER--AAPE--------------- 3541

  Fly   492 VQHLQPGKEYEFMVLSQDKYGDGMFSKQFRFQTLPSPIRADDFDAQQLQHDLGQVTAPAGGLGAP 556
                ..|: |...|  .:|.|......|...|..|..:.|              .:.|||.....
Human  3542 ----DSGR-YRCRV--TNKVGSAEAFAQLLVQGPPGSLPA--------------TSIPAGSTPTV 3585

  Fly   557 WNLTAISNQQ-GWLLHWEHPVQGLEGLRLYAVRWWKEPEHFLIGHAETFDNYYQLRHLKEDTLFK 620
            .....:..:. |..:.:...|....|.:|   ||:||......||:            .:|.:.:
Human  3586 QVTPQLETKSIGASVEFHCAVPSDRGTQL---RWFKEGGQLPPGHS------------VQDGVLR 3635

  Fly   621 VQVL---AVGT----------ETQ-------QSVPSHELLIDVPSQRKVRALIIGSSV 658
            :|.|   ..||          :.|       |::||  :||::  :..|:.:::|.:|
Human  3636 IQNLDQSCQGTYICQAHGPWGKAQASAQLVIQALPS--VLINI--RTSVQTVVVGHAV 3689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 23/98 (23%)
Ig strand C 69..72 CDD:409512 0/2 (0%)
Ig strand E 108..112 CDD:409512 0/3 (0%)
Ig strand F 122..127 CDD:409512 2/4 (50%)
Ig 153..242 CDD:472250 28/91 (31%)
Ig strand B 168..172 CDD:409544 2/3 (67%)
Ig strand C 181..185 CDD:409544 1/5 (20%)
Ig strand E 207..211 CDD:409544 2/4 (50%)
Ig strand F 221..226 CDD:409544 2/4 (50%)
Ig strand G 235..238 CDD:409544 1/2 (50%)
Ig_3 247..322 CDD:464046 19/93 (20%)
Ig 341..428 CDD:472250 28/94 (30%)
Ig strand B 359..363 CDD:409353 2/3 (67%)
Ig strand C 375..380 CDD:409353 2/4 (50%)
Ig strand E 396..400 CDD:409353 1/3 (33%)
Ig strand F 410..415 CDD:409353 2/4 (50%)
Ig strand G 423..426 CDD:409353 1/2 (50%)
FN3 435..524 CDD:238020 19/105 (18%)
FN3 554..636 CDD:238020 17/102 (17%)
HSPG2XP_011539620.1 Ig strand G 3834..3837 CDD:409353
LamG 3848..4008 CDD:238058
EGF_CA <4035..4064 CDD:238011
EGF_CA <4076..4105 CDD:238011
LamG 4117..4266 CDD:238058
EGF 4291..4321 CDD:394967
EGF_CA 4328..4359 CDD:238011
LamG 4386..4545 CDD:238058
SEA 80..193 CDD:214554
LDLa 216..251 CDD:238060
LDLa 302..336 CDD:238060
LDLa 342..376 CDD:238060
LDLa 385..420 CDD:238060
Ig_Perlecan_like 438..515 CDD:143220
Ig strand B 441..447 CDD:143220
Ig strand C 454..459 CDD:143220
Ig strand E 479..483 CDD:143220
Ig strand F 492..498 CDD:143220
Ig strand G 507..513 CDD:143220
LamB 608..734 CDD:214597
EGF_Lam 782..824 CDD:238012
EGF_Lam 831..888 CDD:238012
Laminin_EGF 897..939 CDD:395007
LamB 1003..1130 CDD:214597
EGF_Lam 1176..1225 CDD:238012
EGF_Lam 1227..1282 CDD:238012
Laminin_EGF 1293..1340 CDD:395007
LamB 1574..1699 CDD:214597
EGF_Lam 1746..1794 CDD:238012
Laminin_EGF 1796..1851 CDD:395007
IG_like 1866..1946 CDD:214653
Ig strand B 1877..1881 CDD:409353
Ig strand C 1890..1895 CDD:409353
Ig strand E 1912..1916 CDD:409353
Ig strand F 1926..1931 CDD:409353
Ig strand G 1939..1942 CDD:409353
IgI_Perlecan_like 1954..2039 CDD:409412
Ig strand A 1954..1958 CDD:409412
Ig strand A' 1963..1966 CDD:409412
Ig strand B 1970..1980 CDD:409412
Ig strand C 1986..1990 CDD:409412
Ig strand C' 1993..1995 CDD:409412
Ig strand D 2000..2005 CDD:409412
Ig strand E 2006..2012 CDD:409412
Ig strand F 2019..2027 CDD:409412
Ig strand G 2030..2039 CDD:409412
Ig 2049..2133 CDD:472250
Ig strand B 2066..2070 CDD:409353
Ig strand C 2079..2082 CDD:409353
Ig strand E 2099..2103 CDD:409353
Ig strand F 2113..2118 CDD:409353
Ig strand G 2126..2129 CDD:409353
I-set 2139..2225 CDD:400151
Ig strand B 2156..2160 CDD:409353
Ig strand C 2169..2173 CDD:409353
Ig strand E 2191..2195 CDD:409353
Ig strand F 2205..2210 CDD:409353
IG_like 2240..2317 CDD:214653
Ig strand B 2251..2255 CDD:409353
Ig strand C 2264..2268 CDD:409353
Ig strand E 2284..2287 CDD:409353
Ig strand F 2297..2302 CDD:409353
Ig strand G 2310..2313 CDD:409353
IG_like 2341..2418 CDD:214653
Ig strand B 2352..2356 CDD:409353
Ig strand C 2365..2369 CDD:409353
Ig strand E 2384..2388 CDD:409353
Ig strand F 2398..2403 CDD:409353
Ig strand G 2411..2414 CDD:409353
IG_like 2434..2508 CDD:214653
Ig strand B 2445..2449 CDD:409353
Ig strand C 2458..2462 CDD:409353
Ig strand E 2478..2481 CDD:409353
Ig strand F 2491..2496 CDD:409353
IG_like 2530..2607 CDD:214653
Ig strand C 2554..2558 CDD:409353
Ig strand E 2573..2577 CDD:409353
Ig strand F 2587..2592 CDD:409353
Ig 2620..2703 CDD:472250
Ig strand C 2650..2654 CDD:409353
Ig strand E 2669..2673 CDD:409353
Ig strand F 2683..2688 CDD:409353
IG_like 2731..2800 CDD:214653
Ig strand C 2747..2751 CDD:409353
Ig strand E 2766..2770 CDD:409353
Ig strand F 2780..2785 CDD:409353
IG_like 2819..2896 CDD:214653
Ig strand C 2843..2847 CDD:409353
Ig strand E 2862..2866 CDD:409353
Ig strand F 2876..2881 CDD:409353
Ig strand G 2890..2893 CDD:409353
IG_like 2916..2993 CDD:214653
Ig strand C 2940..2944 CDD:409353
Ig strand E 2959..2963 CDD:409353
Ig strand F 2973..2978 CDD:409353
IG_like 3016..3093 CDD:214653
Ig strand B 3027..3031 CDD:409353
Ig strand C 3040..3044 CDD:409353
Ig strand E 3059..3063 CDD:409353
Ig strand F 3073..3078 CDD:409353
Ig strand G 3086..3089 CDD:409353
IG_like 3115..3192 CDD:214653 23/110 (21%)
Ig strand B 3125..3129 CDD:409353 0/3 (0%)
Ig strand C 3138..3142 CDD:409353 1/17 (6%)
Ig strand E 3158..3161 CDD:409353 1/5 (20%)
Ig strand F 3171..3176 CDD:409353 2/4 (50%)
Ig strand G 3184..3188 CDD:409353 0/3 (0%)
Ig 3205..3291 CDD:472250 29/100 (29%)
Ig strand B 3222..3226 CDD:409353 2/3 (67%)
Ig strand C 3235..3240 CDD:409353 1/4 (25%)
Ig strand E 3257..3261 CDD:409353 1/3 (33%)
Ig strand F 3271..3276 CDD:409353 2/4 (50%)
Ig strand G 3284..3287 CDD:409353 0/2 (0%)
IG_like 3303..3385 CDD:214653 22/94 (23%)
Ig strand B 3313..3317 CDD:409353 1/3 (33%)
Ig strand C 3326..3330 CDD:409353 1/3 (33%)
Ig strand E 3351..3355 CDD:409353 2/13 (15%)
Ig strand F 3365..3370 CDD:409353 2/4 (50%)
Ig 3404..3478 CDD:472250 26/78 (33%)
Ig strand B 3412..3416 CDD:409353 2/3 (67%)
Ig strand C 3425..3429 CDD:409353 1/3 (33%)
Ig strand E 3444..3448 CDD:409353 1/3 (33%)
Ig strand F 3458..3463 CDD:409353 2/4 (50%)
Ig strand G 3471..3474 CDD:409353 1/2 (50%)
I-set 3482..3565 CDD:400151 20/106 (19%)
Ig strand B 3499..3503 CDD:409353 0/3 (0%)
Ig strand C 3512..3516 CDD:409353 1/3 (33%)
Ig strand E 3531..3535 CDD:409353 1/3 (33%)
Ig strand F 3545..3550 CDD:409353 1/5 (20%)
Ig 3588..3666 CDD:472250 16/92 (17%)
Ig strand B 3600..3604 CDD:409353 0/3 (0%)
Ig strand C 3613..3617 CDD:409353 2/6 (33%)
Ig strand E 3632..3636 CDD:409353 0/3 (0%)
Ig strand F 3646..3651 CDD:409353 1/4 (25%)
Ig strand G 3659..3662 CDD:409353 1/2 (50%)
Ig 3676..3755 CDD:472250 3/16 (19%)
Ig strand B 3689..3693 CDD:409353 1/1 (100%)
Ig strand C 3702..3706 CDD:409353
Ig strand E 3721..3725 CDD:409353
Ig strand F 3735..3740 CDD:409353
I-set 3764..3841 CDD:400151
Ig strand B 3775..3779 CDD:409353
Ig strand C 3788..3792 CDD:409353
Ig strand E 3807..3811 CDD:409353
Ig strand F 3821..3826 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.