DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and Fcrl5

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_899045.3 Gene:Fcrl5 / 329693 MGIID:3053558 Length:596 Species:Mus musculus


Alignment Length:267 Identity:59/267 - (22%)
Similarity:96/267 - (35%) Gaps:72/267 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 NLTAIRESDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGGSL---IRIPPVNQTIREGQTAFFHC 172
            ::.||...:...|.|:....|  ..|....||:.:.||..|.   ..|.|.::.:.|||....:|
Mouse   263 HIPAIWTEESKRYQCKAETVN--SQVSKQSTAFIIPV
QRASARFQTHIIPASKLVFEGQLLLLNC 325

  Fly   173 VMKH-PENSQASWYKDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMSDLGEYECKVRNSDGELQTA 236
            .:|. |...:.||||..:|.:|.:.|     ...:....|....:||.|||.|:..||      .
Mouse   326 SVKGVPGPLKFSWYKKDMLNKETKIL-----KSSNAEFKISQVNISDAGEYYCEANNS------R 379

  Fly   237 KAFLNIQYKAKVIYAPPEVFLPYGQPAV----------------LDCHFRANPPLKNLRWEKDGL 285
            ::|::..:       |..:.:|..||.:                |.|..:...|.         :
Mouse   380 RSFVSRAF-------PITIKV
PVSQPVLTLSTGKTQALEGDLMTLHCQSQRGSPC---------I 428

  Fly   286 LFDSYNVPGVFYKM-----------NGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLR 339
            |::      .||:.           .|:.|...:....:|:|.||..|.||.....      .:|
Mouse   429 LYE------FFYENVSLGNSSILSGGGAYFNFSMSTERSGNYYCTADNGLGAQCSE------AIR 481

  Fly   340 PPIFSVT 346
            ..||.:|
Mouse   482 ISIFDMT 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 4/16 (25%)
Ig 43..131 CDD:299845 4/19 (21%)
I-set 153..242 CDD:254352 25/89 (28%)
Ig 157..242 CDD:299845 24/85 (28%)
Ig_2 252..337 CDD:290606 19/111 (17%)
IG_like 260..327 CDD:214653 17/93 (18%)
I-set 341..428 CDD:254352 3/6 (50%)
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
Fcrl5NP_899045.3 Ig 34..112 CDD:299845
IG_like 40..101 CDD:214653
Ig 119..202 CDD:299845
IG_like 127..200 CDD:214653
Ig_2 209..297 CDD:290606 8/35 (23%)
Ig_2 308..391 CDD:290606 26/100 (26%)
IG_like 310..393 CDD:214653 25/100 (25%)
Ig_2 398..484 CDD:290606 17/106 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 522..544
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 561..596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.