DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and dpr8

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:239 Identity:56/239 - (23%)
Similarity:81/239 - (33%) Gaps:49/239 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 GQTAFFHCVMKHPENSQASW--YKDGVLL---QEVQDLVRRFYM-----GPDGSLSIDPTMMSDL 219
            |:|....|.:|:..|...||  ::|..||   :......:||..     ..|.:|.|......|.
  Fly    57 GKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDS 121

  Fly   220 GEYECKVRNSD--GELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDC--HFRANPPLKNLRW 280
            |.|||::..:.  |.    ..:|||......|...||:.:..|....|.|  .|...|| ..:.|
  Fly   122 GIYECQISTTPPIGH----SVYLNIV
EPVTDIIGGPELHINRGSTINLTCIVKFAPEPP-PTVIW 181

  Fly   281 --EKDGLLFDS-------YNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYN-------------- 322
              .::.:.|||       ....||.  ....|...|.....:|.|||||.|              
  Fly   182 SHNREIINFDSPRGGISLVTEKGVL--TTSRLLVQKAITQDSGLYTCTPSNANPTSVRVHIVDGE 244

  Fly   323 -----DLGTDGPSPVISVIVLRPPIFSVTPKAIYIQKLGEAAEL 361
                 ..|.:|.|......||.|.:.......:.:|.:...:.|
  Fly   245 HPAAMHTGNNGNSTASQPPVLLPLVLLTCSTLMLLQLVASCSTL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 22/88 (25%)
Ig 157..242 CDD:299845 22/88 (25%)
Ig_2 252..337 CDD:290606 26/114 (23%)
IG_like 260..327 CDD:214653 22/96 (23%)
I-set 341..428 CDD:254352 2/21 (10%)
IGc2 356..419 CDD:197706 1/6 (17%)
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 20/73 (27%)
V-set 52..143 CDD:284989 23/89 (26%)
IG_like 153..238 CDD:214653 23/87 (26%)
ig 153..232 CDD:278476 23/81 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.