DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdl and Negr1

DIOPT Version :9

Sequence 1:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_036019026.1 Gene:Negr1 / 320840 MGIID:2444846 Length:362 Species:Mus musculus


Alignment Length:376 Identity:82/376 - (21%)
Similarity:130/376 - (34%) Gaps:87/376 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LAIILLMNISCTSAARD----HRRQTNLEAKVGSHVVFNCYIDFPFDAPIPYLVHWTKDNKKIFT 80
            ||.:||...||..|.:.    .....|:..:.|...|..||::.......     |...:..||.
Mouse    15 LAAVLLSLCSCLPAGQSVDFPWAAVDNMLVRKGDTAVLRCYLEDGASKGA-----WLNRSSIIFA 74

  Fly    81 ----W-YEQETSTSELFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHCQVSFPNRSPSVRNNG 140
                | .:...|.|.|         |..::   |:.:..:..:|.|.|.|.|...:...:::   
Mouse    75 GGDKWSVDPRVSISTL---------NKRDY---SLQIQNVDVTDDGPYTCSVQTQHTPRTMQ--- 124

  Fly   141 TAYHLAVQGGSLIRIPPV------NQTIREGQTAFFHCVMKHPENSQASWYKDGVLLQEVQDLVR 199
              .||.||      :||.      :.||.||......|:.........||       :.:....:
Mouse   125 --VHLTVQ------VPPKIYDISNDMTINEGTNVTLTCLATGKPEPVISW-------RHISPSAK 174

  Fly   200 RFYMGPDGSLSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVI--YAP--PEV---FL 257
            .|..|.  .|.|........|||||...|.       .:|.::: |.:||  :||  .|:   .:
Mouse   175 PFENGQ--YLDIYGITRDQAGEYECSAEND-------VSFPDVK-KVRVIVNFAPTIQEIKSGTV 229

  Fly   258 PYGQPAVLDCHFRANPPLKNLRWEK---------DGLLFDSYNVPGVFYKMNGSLFFAKVDENHA 313
            ..|:..::.|.....|| ....|.|         .|::..:::...:       |....|.:.|.
Mouse   230 TPGRSGLIRCEGAGVPP-PAFEWYKGEKRLFNGQQGIIIQNFSTRSI-------LTVTNVTQEHF 286

  Fly   314 GSYTCTPYNDLGTDGPSPVISVIV---LRPPIFSVTPKAIYIQKLGEAAEL 361
            |:|||...|.|||...|..::.|:   ...|:.|..|........|.|.:|
Mouse   287 GNYTCVAANKLGTTNASLPLNQIIEPTTSSPVTSPAPSTAQYGITGSACDL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdlNP_608822.1 IG_like 42..128 CDD:214653 18/90 (20%)
Ig 43..131 CDD:299845 18/92 (20%)
I-set 153..242 CDD:254352 20/94 (21%)
Ig 157..242 CDD:299845 19/90 (21%)
Ig_2 252..337 CDD:290606 21/98 (21%)
IG_like 260..327 CDD:214653 17/75 (23%)
I-set 341..428 CDD:254352 6/21 (29%)
IGc2 356..419 CDD:197706 3/6 (50%)
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
Negr1XP_036019026.1 FR1 38..55 CDD:409353 3/16 (19%)
Ig strand A' 40..46 CDD:409353 1/5 (20%)
IG_like 41..129 CDD:214653 21/109 (19%)
Ig strand B 48..56 CDD:409353 2/7 (29%)
CDR1 56..60 CDD:409353 0/3 (0%)
FR2 61..68 CDD:409353 1/11 (9%)
Ig strand C 61..67 CDD:409353 1/10 (10%)
CDR2 69..79 CDD:409353 2/9 (22%)
Ig strand C' 71..74 CDD:409353 1/2 (50%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 9/46 (20%)
Ig strand D 84..91 CDD:409353 3/15 (20%)
Ig strand E 94..100 CDD:409353 1/8 (13%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 0/3 (0%)
Ig strand G 120..129 CDD:409353 2/13 (15%)
FR4 122..129 CDD:409353 2/11 (18%)
Ig strand A' 139..144 CDD:409353 0/4 (0%)
IGc2 146..204 CDD:197706 15/73 (21%)
Ig strand B 150..157 CDD:409353 1/6 (17%)
Ig strand C 163..168 CDD:409353 2/11 (18%)
Ig strand C' 170..172 CDD:409353 0/1 (0%)
Ig strand E 180..186 CDD:409353 2/7 (29%)
Ig strand F 193..200 CDD:409353 5/6 (83%)
Ig_3 219..295 CDD:404760 16/83 (19%)
putative Ig strand A 219..225 CDD:409353 2/5 (40%)
Ig strand B 235..239 CDD:409353 0/3 (0%)
Ig strand C 248..252 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 1/10 (10%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.